Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_accordion/an_accordion.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_accordion/classes/AnAccordionBlock.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_accordion/translations/it.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_banners/an_banners.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_banners/classes/anBanners.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_banners/hooks_ignore.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/an_banners/translations/it.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/ambjolisearch.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/AmbJolisearchModule.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/AmbIndexation.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/AmbSearch.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/definitions.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/JoliLink.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/JoliLink-1.7.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/classes/AmbJolisearchModuleProxy.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/translations/it.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205

Warning: filesize(): stat failed for /var/www/mangayo.it/modules/ambjolisearch/src/Amb_ProductSearchProvider.php in /var/www/mangayo.it/tools/profiling/Profiler.php on line 205
Manga (2)

Manga

Tutti i manga sono protetti in una perfetta bustina protettiva su misura.

Filtri attivi

  • Categoria : Novel
  • Categoria : Seinen
  • Categoria : Shoujo
  • Categoria : Shounen
  • Categoria : Web Comic
  • Genere: Crimine
  • Genere: Fantascienza
  • Genere: Splatter

Il Terzo Occhio 5

12,00 € 15,00 €

Il Terzo Occhio Volume: 5 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Dr. Stone Reboot: Byakuya

5,61 € 5,90 €

Dr. Stone Reboot: Byakuya Volume: Unico Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Ariadne In The Blue Sky 1

5,61 € 5,90 €

Ariadne In The Blue Sky Volume: 1 Storia: Norihiro Yagi Disegni: Norihiro Yagi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Ariadne In The Blue Sky 3

5,61 € 5,90 €

Ariadne In The Blue Sky Volume: 3 Storia: Norihiro Yagi Disegni: Norihiro Yagi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 1

4,94 € 5,20 €

Dr.Stone Volume: 1 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 4

4,94 € 5,20 €

Dr. Stone Volume: 4 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 5

4,94 € 5,20 €

Dr. Stone Volume: 5 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 6

4,94 € 5,20 €

Dr. Stone Volume: 6 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 7

4,94 € 5,20 €

Dr. Stone Volume: 7 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 8

4,94 € 5,20 €

Dr. Stone Volume: 8 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 9

4,94 € 5,20 €

Dr. Stone Volume: 9 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 10

4,94 € 5,20 €

Dr. Stone Volume: 10 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 12

4,94 € 5,20 €

Dr.Stone Volume: 12 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dr. Stone 13

4,94 € 5,20 €

Dr. Stone Volume: 13 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Death Shield 1

7,13 € 7,50 €

Death Shield Volume: 1 Storia: Luca Molinaro Disegni: Giorgio Battisti Editore: Shockdom Lingua: Italiano

Death Shield 1 Variant...

9,50 € 10,00 €

Death Shield Volume: 1 Variant Laminata Storia: Luca Molinaro Disegni: Giorgio Battisti Editore: Shockdom Lingua: Italiano

Death Shield 2

7,60 € 8,00 €

Death Shield Volume: 2 Storia: Luca Molinaro Disegni: Giorgio Battisti Editore: Shockdom Lingua: Italiano

Death Shield 2 Variant...

9,50 € 10,00 €

Death Shield Volume: 2 Variant Laminata Storia: Luca Molinaro Disegni: Giorgio Battisti Editore: Shockdom Lingua: Italiano

Dr. Stone 2

4,94 € 5,20 €

Dr.Stone Volume: 2 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Dust 8

11,20 € 14,00 €

Dust 8 Volume: Unico Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12.5x16.9 Editore: JPOP Lingua: Italiano

Garon 1

12,00 € 15,00 €

Garon Volume: 1 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Dr. Stone 14

4,94 € 5,20 €

Dr. Stone Volume: 14 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

L'Attacco dei Giganti 1

4,94 € 5,20 €

L'Attacco dei Giganti Volume: 1 Storia: Hajime Isayama Disegni: Hajime Isayama Formato: 11.5x17.5 Editore: Planet Manga Lingua: Italiano

Dr. Stone 3

4,94 € 5,20 €

Dr. Stone Volume: 3 Storia: Riichirō Inagaki Disegni: Boichi Formato: 11.5x17.5 Editore: Star Comics Lingua: Italiano

Load Time 1625 ms
Querying Time 1484 ms
Queries 1136
Memory Peak Usage 30.8 Mb
Included Files 1193 files - 12.20 Mb
PrestaShop Cache - Mb
Global vars 0.37 Mb
PrestaShop Version 8.1.2
PHP Version 8.1.27
MySQL Version 10.5.11-MariaDB-1:10.5.11+maria~buster-log
Memory Limit 512M
Max Execution Time 60s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 2.365 ms 2.365 ms 2.88 Mb 3.2 Mb
__construct 0.009 ms 2.374 ms - Mb 3.2 Mb
init 12.957 ms 15.331 ms 0.50 Mb 3.5 Mb
setMedia 2.235 ms 17.566 ms 0.10 Mb 3.5 Mb
postProcess 0.001 ms 17.567 ms - Mb 3.5 Mb
initHeader 0.000 ms 17.567 ms - Mb 3.5 Mb
initContent 1324 ms 1342 ms 11.58 Mb 15.2 Mb
initFooter 0.002 ms 1342 ms - Mb 15.2 Mb
display 282.823 ms 1625 ms 15.08 Mb 30.8 Mb
Hook Time Memory Usage
DisplayHeader 236.616 ms 4.83 Mb
DisplayProductPriceBlock 94.283 ms 6.22 Mb
displayFooter 44.389 ms 1.39 Mb
displayProductListReviews 21.495 ms 1.71 Mb
ActionProductFlagsModifier 20.725 ms 1.76 Mb
DisplayBeforeBodyClosingTag 16.201 ms 0.39 Mb
displayNav2 13.522 ms 0.41 Mb
Header 13.181 ms 0.37 Mb
DisplayFooter 11.218 ms 0.07 Mb
DisplayTop 9.468 ms 0.37 Mb
DisplayMobileMenu 9.272 ms 0.40 Mb
displayCopyrightContainer 1.877 ms 0.09 Mb
displayNav1 1.863 ms 0.11 Mb
displayLeftColumn 1.719 ms 0.06 Mb
DisplayOverrideTemplate 1.106 ms 0.03 Mb
displayNavFullWidth 1.019 ms 0.08 Mb
displayCopyrightContainerLeft 0.953 ms 0.06 Mb
displayTopLeft 0.845 ms 0.04 Mb
displayBanner 0.840 ms 0.04 Mb
displayClientService 0.837 ms 0.06 Mb
DisplayNavFullWidth 0.483 ms 0.03 Mb
displayTopRight 0.166 ms - Mb
ActionFrontControllerSetMedia 0.146 ms 0.01 Mb
displayFooterLogo 0.138 ms - Mb
DisplayLeftColumn 0.105 ms 0.07 Mb
ProductSearchProvider 0.090 ms - Mb
ModuleRoutes 0.007 ms - Mb
27 hook(s) 502.564 ms 18.60 Mb
Module Time Memory Usage
anblog 2.176 ms 0.02 Mb
ps_emailsubscription 1.378 ms 0.08 Mb
ps_socialfollow 0.072 ms 0.01 Mb
ps_emailalerts 0.100 ms 0.01 Mb
ps_shoppingcart 1.002 ms 0.06 Mb
ets_crosssell 30.613 ms 0.18 Mb
ps_searchbar 0.315 ms 0.01 Mb
an_productextratabs 20.851 ms 1.78 Mb
an_client_service 0.927 ms 0.07 Mb
an_trust_badges 1.962 ms 0.09 Mb
an_user_testimonials 0.137 ms 0.01 Mb
an_accordion 0.096 ms 0.01 Mb
an_homeslider 0.152 ms 0.01 Mb
an_homeproducts 0.162 ms 0.01 Mb
an_banners 0.100 ms 0.01 Mb
an_simplefreeshippingline 0.931 ms 0.05 Mb
an_homecategories 0.098 ms 0.01 Mb
paypal 2.047 ms 0.23 Mb
anscrolltop 0.273 ms 0.06 Mb
darkmode 20.725 ms 0.36 Mb
eicaptcha 0.108 ms - Mb
mangayo_assistant 0.108 ms 0.01 Mb
facebookproductad 203.973 ms 4.63 Mb
an_brandslider 11.682 ms 0.14 Mb
an_megamenu 19.110 ms 0.83 Mb
an_productattributes 93.712 ms 6.13 Mb
an_wishlist 23.282 ms 1.81 Mb
an_stickyaddtocart 0.114 ms 0.01 Mb
an_theme 1.522 ms 0.10 Mb
sociallogin 4.352 ms 0.14 Mb
ps_googleanalytics 2.545 ms 0.12 Mb
luminage_mail 0.142 ms 0.01 Mb
hioutofstocknotification 0.462 ms 0.03 Mb
ambjolisearch 10.582 ms 0.26 Mb
hicookielaw 1.352 ms 0.04 Mb
payplug 4.974 ms 0.44 Mb
app_endpoint 0.118 ms 0.01 Mb
codwfeeplus 2.206 ms 0.15 Mb
ps_facetedsearch 0.363 ms 0.12 Mb
ps_languageselector 0.796 ms 0.05 Mb
ps_currencyselector 1.185 ms 0.07 Mb
ps_customersignin 0.936 ms 0.07 Mb
an_logo 1.080 ms 0.05 Mb
ps_categorytree 1.786 ms 0.07 Mb
ps_contactinfo 1.976 ms 0.09 Mb
ps_linklist 28.056 ms 1.02 Mb
ps_customeraccountlinks 4.400 ms 0.18 Mb
an_copyright 1.121 ms 0.06 Mb
statsdata 13.938 ms 0.30 Mb
49 module(s) 520.096 ms 19.97 Mb

Stopwatch SQL - 1136 queries

# Query Time (ms) Rows Filesort Group By Location
389
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=4)) AND ((fp_1.id_feature_value IN (76, 14, 38, 13, 190))) GROUP BY fp.id_feature_value
266.522 ms 71221463040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
385
SELECT SQL_NO_CACHE p.id_product, sa.out_of_stock FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY IFNULL(p.quantity, 0) <= 0, IFNULL(p.quantity, 0) <= 0 AND FIELD(sa.out_of_stock, 1) DESC, p.position ASC, p.id_product DESC LIMIT 24, 24
216.023 ms 10062341603328 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
386
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69)))
181.173 ms 8717578240 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
394
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM mangayo_product p INNER JOIN mangayo_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28
103.768 ms 4672 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
387
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=3)) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) GROUP BY fp.id_feature_value
82.422 ms 2179394560 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
393
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND cg.id_group='1' AND c.nleft>11 AND c.nright<28 GROUP BY cp.id_category
17.148 ms 1831424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `mangayo_configuration` c
LEFT JOIN `mangayo_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
10.145 ms 2039 /classes/Configuration.php:180
1132
SELECT SQL_NO_CACHE `id_date_range`, `time_end`
FROM `mangayo_date_range`
WHERE `time_end` = (SELECT MAX(`time_end`) FROM `mangayo_date_range`) LIMIT 1
8.706 ms 91431844 /classes/DateRange.php:60
1108
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
5.586 ms 1 /classes/Smarty/SmartyCustom.php:280
79
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `mangayo_hook_module` hm
STRAIGHT_JOIN `mangayo_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `mangayo_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
5.464 ms 610 /classes/Hook.php:456
729
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
5.221 ms 1 /classes/Smarty/SmartyCustom.php:280
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `mangayo_module` m
INNER JOIN mangayo_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `mangayo_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `mangayo_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `mangayo_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
4.483 ms 182 Yes Yes /classes/Hook.php:1233
78
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `mangayo_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `mangayo_hook_alias` ha
INNER JOIN `mangayo_hook` h ON ha.name = h.name
3.802 ms 0 /classes/Hook.php:1292
65
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-06-28 00:00:00",
INTERVAL 10 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `mangayo_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `mangayo_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `mangayo_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `mangayo_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `mangayo_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 11 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
3.762 ms 11258 /classes/Category.php:1059
391
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_1.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN mangayo_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=5)) AND ((fp_1.id_feature_value IN (76, 14, 38, 13, 190))) AND ((fp_2.id_feature_value IN (64, 1279, 1290, 53, 1282, 1285, 1276, 1287, 69))) GROUP BY fp.id_feature_value
3.426 ms 1792 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
45
SELECT SQL_NO_CACHE * FROM `mangayo_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
2.103 ms 18 Yes /classes/ImageType.php:109
40
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
1.983 ms 178 /classes/CartRule.php:418
347
SHOW TABLES LIKE "%mangayo_social_login_%"
1.839 ms 1 /modules/sociallogin/sociallogin.php:186
395
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-06-28 00:00:00',
INTERVAL 10 DAY
)
) > 0) as new
FROM mangayo_product p
LEFT JOIN mangayo_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN mangayo_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN mangayo_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (5967,904,97,98,194,195,197,198,199,200,201,202,204,205,728,729,730,731,766,4176,7624,890,1018,1068)
1.679 ms 24 /classes/ProductAssembler.php:95
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `mangayo_hook` h
WHERE (h.active = 1)
1.610 ms 986 /classes/Hook.php:1332
58
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
1.554 ms 40 Yes /classes/Manufacturer.php:211
33
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `mangayo_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 11
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.459 ms 7 Yes Yes /classes/Category.php:921
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `mangayo_hook`
1.438 ms 986 /classes/Hook.php:1292
1095
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 8 AND `id_shop` = 1
1.412 ms 1 /src/Adapter/EntityMapper.php:79
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
1.356 ms 130 /classes/module/Module.php:345
1135
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `mangayo_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (5967,904,97,98,194,195,197,198,199,200,201,202,204,205,728,729,730,731,766,4176,7624,890,1018,1068) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
1.342 ms 50 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 289) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.323 ms 2 Yes /classes/SpecificPrice.php:576
146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 290) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.311 ms 2 Yes /classes/SpecificPrice.php:576
113
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 287) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.294 ms 2 Yes /classes/SpecificPrice.php:576
102
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 286) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.291 ms 2 Yes /classes/SpecificPrice.php:576
124
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 288) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.279 ms 2 Yes /classes/SpecificPrice.php:576
179
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 293) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.267 ms 2 Yes /classes/SpecificPrice.php:576
91
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 285) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.251 ms 2 Yes /classes/SpecificPrice.php:576
223
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 297) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.235 ms 2 Yes /classes/SpecificPrice.php:576
888
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 199
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.230 ms 2 Yes Yes /classes/Product.php:4578
245
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 299) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.223 ms 2 Yes /classes/SpecificPrice.php:576
190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 294) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.205 ms 2 Yes /classes/SpecificPrice.php:576
212
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 296) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.194 ms 2 Yes /classes/SpecificPrice.php:576
278
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 302) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.194 ms 2 Yes /classes/SpecificPrice.php:576
201
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 295) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.187 ms 2 Yes /classes/SpecificPrice.php:576
256
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 300) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.182 ms 2 Yes /classes/SpecificPrice.php:576
75
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 284) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.181 ms 2 Yes /classes/SpecificPrice.php:576
311
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 305) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.173 ms 2 Yes /classes/SpecificPrice.php:576
168
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 292) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.167 ms 2 Yes /classes/SpecificPrice.php:576
157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 291) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.165 ms 2 Yes /classes/SpecificPrice.php:576
333
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 307) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.163 ms 2 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 301) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.161 ms 2 Yes /classes/SpecificPrice.php:576
234
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 298) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.143 ms 2 Yes /classes/SpecificPrice.php:576
322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 306) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.142 ms 2 Yes /classes/SpecificPrice.php:576
37
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
1.140 ms 130 /classes/module/Module.php:345
792
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5967
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.135 ms 2 Yes Yes /classes/Product.php:4578
1032
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7624
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.133 ms 2 Yes Yes /classes/Product.php:4578
390
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
1.132 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
876
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 198
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.131 ms 2 Yes Yes /classes/Product.php:4578
948
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 205
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.129 ms 2 Yes Yes /classes/Product.php:4578
300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 304) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.128 ms 2 Yes /classes/SpecificPrice.php:576
1089
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 3 AND `id_shop` = 1
1.125 ms 1 /src/Adapter/EntityMapper.php:79
18
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `mangayo_meta` m
LEFT JOIN `mangayo_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
1.114 ms 59 Yes /classes/Dispatcher.php:654
804
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 904
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.109 ms 2 Yes Yes /classes/Product.php:4578
1044
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 890
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.109 ms 2 Yes Yes /classes/Product.php:4578
1068
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1068
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.109 ms 2 Yes Yes /classes/Product.php:4578
972
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 729
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.108 ms 2 Yes Yes /classes/Product.php:4578
840
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 194
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.099 ms 2 Yes Yes /classes/Product.php:4578
852
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 195
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.098 ms 2 Yes Yes /classes/Product.php:4578
864
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 197
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.098 ms 2 Yes Yes /classes/Product.php:4578
912
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 201
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.098 ms 2 Yes Yes /classes/Product.php:4578
924
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 202
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.098 ms 2 Yes Yes /classes/Product.php:4578
936
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 204
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.098 ms 2 Yes Yes /classes/Product.php:4578
1008
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 766
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.097 ms 2 Yes Yes /classes/Product.php:4578
1056
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1018
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.096 ms 2 Yes Yes /classes/Product.php:4578
816
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 97
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.095 ms 2 Yes Yes /classes/Product.php:4578
1020
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4176
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.094 ms 2 Yes Yes /classes/Product.php:4578
960
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 728
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.090 ms 2 Yes Yes /classes/Product.php:4578
984
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 730
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.089 ms 2 Yes Yes /classes/Product.php:4578
828
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 98
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.086 ms 2 Yes Yes /classes/Product.php:4578
996
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 731
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.080 ms 2 Yes Yes /classes/Product.php:4578
900
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 200
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.079 ms 2 Yes Yes /classes/Product.php:4578
384
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
1.074 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
289
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 303) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.053 ms 2 Yes /classes/SpecificPrice.php:576
84
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 284 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.039 ms 0 /classes/Cart.php:1410
107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 286 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.011 ms 0 /classes/Cart.php:1410
1097
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 9 AND `id_shop` = 1
1.004 ms 1 /src/Adapter/EntityMapper.php:79
374
SELECT SQL_NO_CACHE t.*,
tl.*
FROM `mangayo_hicookietype` t
LEFT JOIN `mangayo_hicookietype_lang` `tl` ON t.`id_type` = tl.`id_type`
LEFT JOIN `mangayo_hicookietype_shop` `ts` ON t.`id_type` = ts.`id_type`
WHERE (tl.`id_lang` = 1) AND (ts.`id_shop` = 1)
ORDER BY t.position
1.001 ms 9 Yes /modules/hicookielaw/classes/type.php:68
129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 288 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 288 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.994 ms 0 /classes/Cart.php:1410
118
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 287 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.981 ms 0 /classes/Cart.php:1410
151
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 290 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 290 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.981 ms 0 /classes/Cart.php:1410
59
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`, cl.`link_rewrite`, category_shop.`id_shop`
FROM `mangayo_category` c
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE `id_lang` = 1
AND c.`id_parent` = 2
AND `active` = 1
GROUP BY c.`id_category`
ORDER BY category_shop.`position` ASC
0.946 ms 15 Yes Yes /classes/Category.php:1148
96
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 285 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.943 ms 0 /classes/Cart.php:1410
39
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.916 ms 465 /classes/CartRule.php:357
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 289 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 289 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.913 ms 0 /classes/Cart.php:1410
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 294 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 294 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.912 ms 0 /classes/Cart.php:1410
294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 303 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.911 ms 0 /classes/Cart.php:1410
283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 302 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.910 ms 0 /classes/Cart.php:1410
162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 291 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 291 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.906 ms 0 /classes/Cart.php:1410
206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 295 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.906 ms 0 /classes/Cart.php:1410
217
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 296 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.903 ms 0 /classes/Cart.php:1410
250
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 299 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.901 ms 0 /classes/Cart.php:1410
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 304 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.898 ms 0 /classes/Cart.php:1410
327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 306 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.898 ms 0 /classes/Cart.php:1410
173
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 292 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 292 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.894 ms 0 /classes/Cart.php:1410
261
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 300 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 300 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.894 ms 0 /classes/Cart.php:1410
272
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 301 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 301 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.893 ms 0 /classes/Cart.php:1410
316
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 305 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.891 ms 0 /classes/Cart.php:1410
108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 286
ORDER BY f.position ASC
0.889 ms 7 Yes /classes/Product.php:5993
239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 298 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.887 ms 0 /classes/Cart.php:1410
130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 288
ORDER BY f.position ASC
0.881 ms 7 Yes /classes/Product.php:5993
85
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 284
ORDER BY f.position ASC
0.879 ms 7 Yes /classes/Product.php:5993
338
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 307 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.878 ms 0 /classes/Cart.php:1410
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 289
ORDER BY f.position ASC
0.869 ms 7 Yes /classes/Product.php:5993
184
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 293 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.867 ms 0 /classes/Cart.php:1410
228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 297 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.864 ms 0 /classes/Cart.php:1410
97
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 285
ORDER BY f.position ASC
0.863 ms 7 Yes /classes/Product.php:5993
163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 291
ORDER BY f.position ASC
0.860 ms 7 Yes /classes/Product.php:5993
41
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.856 ms 465 /classes/CartRule.php:357
152
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 290
ORDER BY f.position ASC
0.855 ms 7 Yes /classes/Product.php:5993
753
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
0.855 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
578
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 730) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.852 ms 2 Yes /classes/SpecificPrice.php:576
119
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 287
ORDER BY f.position ASC
0.848 ms 7 Yes /classes/Product.php:5993
382
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `mangayo_feature` f  INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `mangayo_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `mangayo_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.847 ms 49 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 302
ORDER BY f.position ASC
0.845 ms 7 Yes /classes/Product.php:5993
69
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 284) AND (b.`id_shop` = 1) LIMIT 1
0.843 ms 1 /src/Adapter/EntityMapper.php:71
218
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 296
ORDER BY f.position ASC
0.839 ms 7 Yes /classes/Product.php:5993
1071
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.838 ms 40 Yes /classes/Manufacturer.php:211
240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 298
ORDER BY f.position ASC
0.837 ms 7 Yes /classes/Product.php:5993
328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 306
ORDER BY f.position ASC
0.834 ms 7 Yes /classes/Product.php:5993
42
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.829 ms 1 /classes/CartRule.php:418
339
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 307
ORDER BY f.position ASC
0.827 ms 7 Yes /classes/Product.php:5993
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 294
ORDER BY f.position ASC
0.823 ms 7 Yes /classes/Product.php:5993
100
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 286) AND (b.`id_shop` = 1) LIMIT 1
0.821 ms 1 /src/Adapter/EntityMapper.php:71
155
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 291) AND (b.`id_shop` = 1) LIMIT 1
0.820 ms 1 /src/Adapter/EntityMapper.php:71
174
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 292
ORDER BY f.position ASC
0.820 ms 7 Yes /classes/Product.php:5993
768
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
0.819 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
598
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 766) AND (b.`id_shop` = 1) LIMIT 1
0.814 ms 1 /src/Adapter/EntityMapper.php:71
111
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 287) AND (b.`id_shop` = 1) LIMIT 1
0.812 ms 1 /src/Adapter/EntityMapper.php:71
317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 305
ORDER BY f.position ASC
0.807 ms 7 Yes /classes/Product.php:5993
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM mangayo_shop_group gs
LEFT JOIN mangayo_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN mangayo_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.806 ms 1 Yes /classes/shop/Shop.php:715
89
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 285) AND (b.`id_shop` = 1) LIMIT 1
0.806 ms 1 /src/Adapter/EntityMapper.php:71
251
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 299
ORDER BY f.position ASC
0.799 ms 7 Yes /classes/Product.php:5993
144
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 290) AND (b.`id_shop` = 1) LIMIT 1
0.794 ms 1 /src/Adapter/EntityMapper.php:71
229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 297
ORDER BY f.position ASC
0.787 ms 7 Yes /classes/Product.php:5993
232
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 298) AND (b.`id_shop` = 1) LIMIT 1
0.786 ms 1 /src/Adapter/EntityMapper.php:71
207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 295
ORDER BY f.position ASC
0.784 ms 7 Yes /classes/Product.php:5993
295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 303
ORDER BY f.position ASC
0.781 ms 7 Yes /classes/Product.php:5993
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 304
ORDER BY f.position ASC
0.780 ms 7 Yes /classes/Product.php:5993
273
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 301
ORDER BY f.position ASC
0.779 ms 7 Yes /classes/Product.php:5993
262
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 300
ORDER BY f.position ASC
0.777 ms 7 Yes /classes/Product.php:5993
383
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
0.777 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
133
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 289) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
265
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 301) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
122
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 288) AND (b.`id_shop` = 1) LIMIT 1
0.771 ms 1 /src/Adapter/EntityMapper.php:71
19
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.765 ms 1 /src/Adapter/EntityMapper.php:71
185
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 293
ORDER BY f.position ASC
0.764 ms 7 Yes /classes/Product.php:5993
166
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 292) AND (b.`id_shop` = 1) LIMIT 1
0.763 ms 1 /src/Adapter/EntityMapper.php:71
287
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 303) AND (b.`id_shop` = 1) LIMIT 1
0.760 ms 1 /src/Adapter/EntityMapper.php:71
199
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 295) AND (b.`id_shop` = 1) LIMIT 1
0.758 ms 1 /src/Adapter/EntityMapper.php:71
534
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 204) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.756 ms 2 Yes /classes/SpecificPrice.php:576
276
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 302) AND (b.`id_shop` = 1) LIMIT 1
0.755 ms 1 /src/Adapter/EntityMapper.php:71
243
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 299) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
221
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 297) AND (b.`id_shop` = 1) LIMIT 1
0.749 ms 1 /src/Adapter/EntityMapper.php:71
210
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 296) AND (b.`id_shop` = 1) LIMIT 1
0.744 ms 1 /src/Adapter/EntityMapper.php:71
779
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `mangayo_category` c
INNER JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `mangayo_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 6
AND nleft >= 11 AND nright <= 28
AND c.id_category IN (
SELECT id_category
FROM `mangayo_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cs.`position` ASC
0.740 ms 9 Yes /modules/ps_categorytree/ps_categorytree.php:166
177
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 293) AND (b.`id_shop` = 1) LIMIT 1
0.738 ms 1 /src/Adapter/EntityMapper.php:71
254
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 300) AND (b.`id_shop` = 1) LIMIT 1
0.738 ms 1 /src/Adapter/EntityMapper.php:71
446
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 194) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.737 ms 2 Yes /classes/SpecificPrice.php:576
188
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 294) AND (b.`id_shop` = 1) LIMIT 1
0.736 ms 1 /src/Adapter/EntityMapper.php:71
320
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 306) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
34
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 88) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
309
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 305) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
331
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 307) AND (b.`id_shop` = 1) LIMIT 1
0.731 ms 1 /src/Adapter/EntityMapper.php:71
298
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 304) AND (b.`id_shop` = 1) LIMIT 1
0.730 ms 1 /src/Adapter/EntityMapper.php:71
477
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 198) AND (b.`id_shop` = 1) LIMIT 1
0.724 ms 1 /src/Adapter/EntityMapper.php:71
158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 291)
0.721 ms 1 /classes/Product.php:3857
52
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a0
LEFT JOIN `mangayo_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 11) AND (a0.`nright` > 28) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.720 ms 6 /classes/PrestaShopCollection.php:383
412
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 904) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.705 ms 2 Yes /classes/SpecificPrice.php:576
589
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 731) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.703 ms 2 Yes /classes/SpecificPrice.php:576
76
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 284)
0.699 ms 1 /classes/Product.php:3857
523
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 202) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.698 ms 2 Yes /classes/SpecificPrice.php:576
17
SELECT SQL_NO_CACHE name, alias FROM `mangayo_hook_alias`
0.695 ms 88 /classes/Hook.php:339
754
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.693 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
767
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.692 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
468
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 197) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.690 ms 2 Yes /classes/SpecificPrice.php:576
567
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 729) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.688 ms 2 Yes /classes/SpecificPrice.php:576
400
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5967) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.685 ms 3 Yes /classes/SpecificPrice.php:576
600
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 766) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.685 ms 2 Yes /classes/SpecificPrice.php:576
114
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 287)
0.683 ms 1 /classes/Product.php:3857
499
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 200) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
38
SELECT SQL_NO_CACHE 1 FROM mangayo_cart_product cp INNER JOIN mangayo_product p
ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.678 ms 1 /classes/Cart.php:4192
611
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4176) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.676 ms 3 Yes /classes/SpecificPrice.php:576
656
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1068) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.673 ms 2 Yes /classes/SpecificPrice.php:576
622
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7624) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.668 ms 3 Yes /classes/SpecificPrice.php:576
545
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 205) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.667 ms 2 Yes /classes/SpecificPrice.php:576
769
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.661 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
556
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 728) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.660 ms 2 Yes /classes/SpecificPrice.php:576
512
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 201) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.658 ms 2 Yes /classes/SpecificPrice.php:576
473
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 197 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 197 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.655 ms 0 /classes/Cart.php:1410
434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 98) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.653 ms 2 Yes /classes/SpecificPrice.php:576
633
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 890) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.652 ms 2 Yes /classes/SpecificPrice.php:576
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 290
AND image_shop.`cover` = 1 LIMIT 1
0.651 ms 1 /classes/Product.php:3570
645
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1018) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.649 ms 2 Yes /classes/SpecificPrice.php:576
479
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 198) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.648 ms 2 Yes /classes/SpecificPrice.php:576
662
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1068
ORDER BY f.position ASC
0.648 ms 7 Yes /classes/Product.php:5993
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `mangayo_hook_alias`
0.647 ms 88 /classes/Hook.php:287
501
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 200) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.646 ms 2 Yes /classes/SpecificPrice.php:576
554
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 728) AND (b.`id_shop` = 1) LIMIT 1
0.642 ms 1 /src/Adapter/EntityMapper.php:71
377
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12211) LIMIT 1
0.641 ms 1 /src/Adapter/EntityMapper.php:71
457
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 195) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.638 ms 2 Yes /classes/SpecificPrice.php:576
423
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 97) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.637 ms 2 Yes /classes/SpecificPrice.php:576
392
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.632 ms 87 Yes /classes/Category.php:721
594
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 731 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 731 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.631 ms 0 /classes/Cart.php:1410
490
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 199) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.630 ms 2 Yes /classes/SpecificPrice.php:576
160
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 291 AND `id_group` = 1 LIMIT 1
0.622 ms 0 /classes/GroupReduction.php:156
763
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.621 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
550
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 205 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 205 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.620 ms 0 /classes/Cart.php:1410
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM mangayo_shop_url su
LEFT JOIN mangayo_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'mangayo.it' OR su.domain_ssl = 'mangayo.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.619 ms 1 Yes /classes/shop/Shop.php:1364
344
SELECT SQL_NO_CACHE c.id_category, cl.name, cl.link_rewrite FROM mangayo_category c LEFT JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN mangayo_category_lang cl ON (cl.id_category = c.id_category AND cl.id_shop = 1 )WHERE c.nleft <= 11 AND c.nright >= 28 AND c.nleft >= 2 AND c.nright <= 173 AND cl.id_lang = 1 AND c.level_depth > 1 ORDER BY c.level_depth ASC
0.619 ms 6 Yes /modules/facebookproductad/lib/moduleTools.php:526
484
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 198 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 198 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.616 ms 0 /classes/Cart.php:1410
510
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 201) AND (b.`id_shop` = 1) LIMIT 1
0.616 ms 1 /src/Adapter/EntityMapper.php:71
661
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1068 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1068 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.613 ms 0 /classes/Cart.php:1410
623
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7624)
0.612 ms 1 /classes/Product.php:3857
279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 302)
0.611 ms 1 /classes/Product.php:3857
153
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 291
AND image_shop.`cover` = 1 LIMIT 1
0.610 ms 1 /classes/Product.php:3570
749
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.610 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
474
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 197
ORDER BY f.position ASC
0.609 ms 7 Yes /classes/Product.php:5993
92
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 285)
0.608 ms 1 /classes/Product.php:3857
103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 286)
0.608 ms 1 /classes/Product.php:3857
405
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5967 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5967 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.607 ms 0 /classes/Cart.php:1410
235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 298)
0.606 ms 1 /classes/Product.php:3857
35
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 90) AND (b.`id_shop` = 1) LIMIT 1
0.605 ms 1 /src/Adapter/EntityMapper.php:71
590
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 731)
0.604 ms 1 /classes/Product.php:3857
752
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.603 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
469
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 197)
0.601 ms 1 /classes/Product.php:3857
224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 297)
0.597 ms 1 /classes/Product.php:3857
312
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 305)
0.594 ms 1 /classes/Product.php:3857
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 289)
0.593 ms 1 /classes/Product.php:3857
616
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4176 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4176 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.592 ms 0 /classes/Cart.php:1410
561
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 728 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 728 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.592 ms 0 /classes/Cart.php:1410
638
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 890 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 890 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.592 ms 0 /classes/Cart.php:1410
180
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 293)
0.591 ms 1 /classes/Product.php:3857
120
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 288
AND image_shop.`cover` = 1 LIMIT 1
0.589 ms 1 /classes/Product.php:3570
417
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 904 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 904 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.589 ms 0 /classes/Cart.php:1410
428
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 97 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 97 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.589 ms 0 /classes/Cart.php:1410
748
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.588 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
421
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 97) AND (b.`id_shop` = 1) LIMIT 1
0.588 ms 1 /src/Adapter/EntityMapper.php:71
213
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 296)
0.586 ms 1 /classes/Product.php:3857
539
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 204 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 204 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.586 ms 0 /classes/Cart.php:1410
398
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5967) AND (b.`id_shop` = 1) LIMIT 1
0.585 ms 1 /src/Adapter/EntityMapper.php:71
747
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.585 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM mangayo_shop s
LEFT JOIN mangayo_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.584 ms 1 /classes/shop/Shop.php:218
1105
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 23 AND `id_shop` = 1
0.584 ms 1 /src/Adapter/EntityMapper.php:79
466
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 197) AND (b.`id_shop` = 1) LIMIT 1
0.583 ms 1 /src/Adapter/EntityMapper.php:71
565
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 729) AND (b.`id_shop` = 1) LIMIT 1
0.582 ms 1 /src/Adapter/EntityMapper.php:71
329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 307
AND image_shop.`cover` = 1 LIMIT 1
0.582 ms 1 /classes/Product.php:3570
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 294)
0.581 ms 1 /classes/Product.php:3857
147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 290)
0.580 ms 1 /classes/Product.php:3857
770
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.579 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 288)
0.579 ms 1 /classes/Product.php:3857
646
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1018)
0.579 ms 1 /classes/Product.php:3857
517
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 201 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 201 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.578 ms 0 /classes/Cart.php:1410
409
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 904) AND (b.`id_shop` = 1) LIMIT 1
0.575 ms 1 /src/Adapter/EntityMapper.php:71
488
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 199) AND (b.`id_shop` = 1) LIMIT 1
0.575 ms 1 /src/Adapter/EntityMapper.php:71
650
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1018 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1018 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.575 ms 0 /classes/Cart.php:1410
627
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7624 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7624 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.573 ms 0 /classes/Cart.php:1410
764
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.573 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 304)
0.572 ms 1 /classes/Product.php:3857
572
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 729 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 729 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.572 ms 0 /classes/Cart.php:1410
388
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
0.571 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
521
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 202) AND (b.`id_shop` = 1) LIMIT 1
0.571 ms 1 /src/Adapter/EntityMapper.php:71
86
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.570 ms 0 /classes/tax/TaxRulesTaxManager.php:109
451
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 194 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 194 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.570 ms 0 /classes/Cart.php:1410
323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 306)
0.569 ms 1 /classes/Product.php:3857
80
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 211)
AND ('00133' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '00133')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.569 ms 0 /classes/tax/TaxRulesTaxManager.php:109
268
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 301)
0.568 ms 1 /classes/Product.php:3857
762
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.567 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
642
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1018) AND (b.`id_shop` = 1) LIMIT 1
0.566 ms 1 /src/Adapter/EntityMapper.php:71
6
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.565 ms 1 /src/Adapter/EntityMapper.php:71
495
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 199 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 199 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.565 ms 0 /classes/Cart.php:1410
334
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 307)
0.564 ms 1 /classes/Product.php:3857
257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 300)
0.564 ms 1 /classes/Product.php:3857
532
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 204) AND (b.`id_shop` = 1) LIMIT 1
0.563 ms 1 /src/Adapter/EntityMapper.php:71
246
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 299)
0.562 ms 1 /classes/Product.php:3857
480
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 198)
0.562 ms 1 /classes/Product.php:3857
219
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 297
AND image_shop.`cover` = 1 LIMIT 1
0.560 ms 1 /classes/Product.php:3570
506
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 200 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 200 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.560 ms 0 /classes/Cart.php:1410
443
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 194) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
631
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 890) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
432
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 98) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
587
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 731) AND (b.`id_shop` = 1) LIMIT 1
0.556 ms 1 /src/Adapter/EntityMapper.php:71
186
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 294
AND image_shop.`cover` = 1 LIMIT 1
0.555 ms 1 /classes/Product.php:3570
455
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 195) AND (b.`id_shop` = 1) LIMIT 1
0.555 ms 1 /src/Adapter/EntityMapper.php:71
485
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 198
ORDER BY f.position ASC
0.555 ms 7 Yes /classes/Product.php:5993
528
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 202 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 202 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.555 ms 0 /classes/Cart.php:1410
381
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM mangayo_layered_category
WHERE controller = 'category'
AND id_category = 11
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.554 ms 6 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
595
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 731
ORDER BY f.position ASC
0.553 ms 7 Yes /classes/Product.php:5993
654
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1068) AND (b.`id_shop` = 1) LIMIT 1
0.552 ms 1 /src/Adapter/EntityMapper.php:71
1093
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 19 AND `id_shop` = 1
0.552 ms 1 /src/Adapter/EntityMapper.php:79
617
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4176
ORDER BY f.position ASC
0.551 ms 7 Yes /classes/Product.php:5993
620
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7624) AND (b.`id_shop` = 1) LIMIT 1
0.550 ms 1 /src/Adapter/EntityMapper.php:71
902
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (201) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.549 ms 1 Yes Yes /classes/Product.php:4504
543
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 205) AND (b.`id_shop` = 1) LIMIT 1
0.549 ms 1 /src/Adapter/EntityMapper.php:71
573
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 729
ORDER BY f.position ASC
0.548 ms 7 Yes /classes/Product.php:5993
751
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.548 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 299
AND image_shop.`cover` = 1 LIMIT 1
0.547 ms 1 /classes/Product.php:3570
551
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 205
ORDER BY f.position ASC
0.547 ms 7 Yes /classes/Product.php:5993
24
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.547 ms 1 /src/Adapter/EntityMapper.php:71
169
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 292)
0.547 ms 1 /classes/Product.php:3857
296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 304
AND image_shop.`cover` = 1 LIMIT 1
0.547 ms 1 /classes/Product.php:3570
202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 295)
0.546 ms 1 /classes/Product.php:3857
418
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 904
ORDER BY f.position ASC
0.546 ms 7 Yes /classes/Product.php:5993
609
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4176) AND (b.`id_shop` = 1) LIMIT 1
0.546 ms 1 /src/Adapter/EntityMapper.php:71
208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 296
AND image_shop.`cover` = 1 LIMIT 1
0.545 ms 1 /classes/Product.php:3570
452
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 194
ORDER BY f.position ASC
0.545 ms 7 Yes /classes/Product.php:5993
576
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 730) AND (b.`id_shop` = 1) LIMIT 1
0.545 ms 1 /src/Adapter/EntityMapper.php:71
605
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 766 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 766 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.544 ms 0 /classes/Cart.php:1410
175
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 293
AND image_shop.`cover` = 1 LIMIT 1
0.543 ms 1 /classes/Product.php:3570
462
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 195 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 195 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.543 ms 0 /classes/Cart.php:1410
628
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7624
ORDER BY f.position ASC
0.543 ms 14 Yes /classes/Product.php:5993
518
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 201
ORDER BY f.position ASC
0.543 ms 7 Yes /classes/Product.php:5993
755
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.542 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
263
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 301
AND image_shop.`cover` = 1 LIMIT 1
0.540 ms 1 /classes/Product.php:3570
639
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 890
ORDER BY f.position ASC
0.538 ms 7 Yes /classes/Product.php:5993
87
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 285
AND image_shop.`cover` = 1 LIMIT 1
0.538 ms 1 /classes/Product.php:3570
290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 303)
0.537 ms 1 /classes/Product.php:3857
439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 98 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 98 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.537 ms 0 /classes/Cart.php:1410
1133
UPDATE `mangayo_page_viewed`
SET `counter` = `counter` + 1
WHERE `id_date_range` = 9307
AND `id_page` = 48
AND `id_shop` = 1
0.537 ms 1 /classes/Page.php:131
8
SELECT SQL_NO_CACHE *
FROM `mangayo_lang` a
LEFT JOIN `mangayo_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.536 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `mangayo_lang` l
JOIN mangayo_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.536 ms 1 /classes/Language.php:1216
583
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 730 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 730 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.536 ms 0 /classes/Cart.php:1410
109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 287
AND image_shop.`cover` = 1 LIMIT 1
0.535 ms 1 /classes/Product.php:3570
1101
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 11 AND `id_shop` = 1
0.535 ms 1 /src/Adapter/EntityMapper.php:79
44
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.534 ms 0 /classes/module/Module.php:2109
98
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 286
AND image_shop.`cover` = 1 LIMIT 1
0.534 ms 1 /classes/Product.php:3570
540
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 204
ORDER BY f.position ASC
0.533 ms 7 Yes /classes/Product.php:5993
562
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 728
ORDER BY f.position ASC
0.532 ms 7 Yes /classes/Product.php:5993
579
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 730)
0.532 ms 1 /classes/Product.php:3857
230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 298
AND image_shop.`cover` = 1 LIMIT 1
0.531 ms 1 /classes/Product.php:3570
274
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 302
AND image_shop.`cover` = 1 LIMIT 1
0.531 ms 1 /classes/Product.php:3570
463
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 195
ORDER BY f.position ASC
0.530 ms 7 Yes /classes/Product.php:5993
496
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 199
ORDER BY f.position ASC
0.530 ms 7 Yes /classes/Product.php:5993
1128
SELECT SQL_NO_CACHE `id_page`
FROM `mangayo_page`
WHERE `id_page_type` = 7 AND `id_object` = 11 LIMIT 1
0.530 ms 1 /classes/Page.php:83
1111
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php'
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme"
0.529 ms 1 /classes/Smarty/SmartyCustom.php:184
782
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5967) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.529 ms 1 Yes Yes /classes/Product.php:4504
940
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 205)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.528 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
938
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (205) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.527 ms 1 Yes Yes /classes/Product.php:4504
131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 289
AND image_shop.`cover` = 1 LIMIT 1
0.526 ms 1 /classes/Product.php:3570
406
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5967
ORDER BY f.position ASC
0.526 ms 7 Yes /classes/Product.php:5993
606
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 766
ORDER BY f.position ASC
0.526 ms 7 Yes /classes/Product.php:5993
746
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
0.526 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
429
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 97
ORDER BY f.position ASC
0.525 ms 7 Yes /classes/Product.php:5993
584
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 730
ORDER BY f.position ASC
0.525 ms 7 Yes /classes/Product.php:5993
252
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 300
AND image_shop.`cover` = 1 LIMIT 1
0.523 ms 1 /classes/Product.php:3570
307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 305
AND image_shop.`cover` = 1 LIMIT 1
0.522 ms 1 /classes/Product.php:3570
794
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (904) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.522 ms 1 Yes Yes /classes/Product.php:4504
1118
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php'
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme"
0.522 ms 1 /classes/Smarty/SmartyCustom.php:184
1131
INSERT INTO `mangayo_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('7334481', '', 'mangayo.it/11-manga?page=2&q=Categoria+-Novel-Seinen+-Shoujo-Shounen-Web+Comic%2FGenere-Crimine-Fantascienza-Splatter', '', '2024-06-28 13:08:25')
0.522 ms 1 /classes/ObjectModel.php:622
164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 292
AND image_shop.`cover` = 1 LIMIT 1
0.522 ms 1 /classes/Product.php:3570
285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 303
AND image_shop.`cover` = 1 LIMIT 1
0.521 ms 1 /classes/Product.php:3570
318
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 306
AND image_shop.`cover` = 1 LIMIT 1
0.520 ms 1 /classes/Product.php:3570
424
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 97)
0.519 ms 1 /classes/Product.php:3857
878
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (199) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.519 ms 1 Yes Yes /classes/Product.php:4504
71
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `id_product` != 0 LIMIT 1
0.518 ms 8769 /classes/SpecificPrice.php:297
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 295
AND image_shop.`cover` = 1 LIMIT 1
0.518 ms 1 /classes/Product.php:3570
1107
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php'
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme"
0.518 ms 1 /classes/Smarty/SmartyCustom.php:184
998
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (766) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.517 ms 1 Yes Yes /classes/Product.php:4504
154
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.516 ms 1 /classes/Product.php:5639
842
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (195) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.515 ms 1 Yes Yes /classes/Product.php:4504
866
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (198) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.514 ms 1 Yes Yes /classes/Product.php:4504
806
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (97) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.513 ms 1 Yes Yes /classes/Product.php:4504
507
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 200
ORDER BY f.position ASC
0.512 ms 7 Yes /classes/Product.php:5993
962
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (729) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4504
1129
INSERT INTO `mangayo_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('7563457', '48', '316205729', '', '1', '1', '2024-06-28 13:08:25')
0.511 ms 1 /classes/ObjectModel.php:622
29
SELECT SQL_NO_CACHE *
FROM `mangayo_group` a
LEFT JOIN `mangayo_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.510 ms 1 /src/Adapter/EntityMapper.php:71
599
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 766
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.510 ms 1 /classes/SpecificPrice.php:259
31
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.509 ms 1 /classes/ObjectModel.php:1729
766
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.509 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 98
ORDER BY f.position ASC
0.508 ms 7 Yes /classes/Product.php:5993
1046
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1018) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.507 ms 1 Yes Yes /classes/Product.php:4504
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `mangayo_lang` l
LEFT JOIN `mangayo_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.507 ms 1 /classes/Language.php:1080
74
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.507 ms 1 /classes/SpecificPrice.php:259
66
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 284
AND image_shop.`cover` = 1 LIMIT 1
0.506 ms 1 /classes/Product.php:3570
49
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.505 ms 1 /src/Adapter/EntityMapper.php:71
529
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 202
ORDER BY f.position ASC
0.505 ms 7 Yes /classes/Product.php:5993
818
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (98) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.505 ms 1 Yes Yes /classes/Product.php:4504
854
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (197) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.505 ms 1 Yes Yes /classes/Product.php:4504
853
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 195
0.504 ms 1 /classes/Product.php:2902
7
SELECT SQL_NO_CACHE *
FROM `mangayo_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.502 ms 1 /src/Adapter/EntityMapper.php:71
340
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) LIMIT 1
0.502 ms 1 /src/Adapter/EntityMapper.php:71
651
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1018
ORDER BY f.position ASC
0.502 ms 7 Yes /classes/Product.php:5993
830
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (194) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.502 ms 1 Yes Yes /classes/Product.php:4504
1125
INSERT INTO `mangayo_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
0.501 ms 1 /classes/ObjectModel.php:622
914
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (202) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.500 ms 1 Yes Yes /classes/Product.php:4504
1034
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (890) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.500 ms 1 Yes Yes /classes/Product.php:4504
64
SELECT SQL_NO_CACHE id_order
FROM `mangayo_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.499 ms 1 /modules/facebookproductad/lib/dao/moduleDao.php:383
926
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (204) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.499 ms 1 Yes Yes /classes/Product.php:4504
1126
SELECT SQL_NO_CACHE `id_guest`
FROM `mangayo_connections`
WHERE `id_guest` = 7563457
AND `date_add` > '2024-06-28 12:38:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.499 ms 1 Yes /classes/Connection.php:168
974
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (730) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.498 ms 1 Yes Yes /classes/Product.php:4504
513
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 201)
0.495 ms 1 /classes/Product.php:3857
54
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "productcomments" LIMIT 1
0.494 ms 1 /classes/module/Module.php:2636
26
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.493 ms 1 /src/Adapter/EntityMapper.php:71
890
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (200) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.493 ms 1 Yes Yes /classes/Product.php:4504
950
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (728) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.492 ms 1 Yes Yes /classes/Product.php:4504
1009
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 766
0.491 ms 1 /classes/Product.php:2902
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM mangayo_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.490 ms 1 /classes/shop/ShopUrl.php:182
22
SELECT SQL_NO_CACHE value FROM `mangayo_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.487 ms 1 /classes/shop/Shop.php:1183
1058
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1068) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.487 ms 1 Yes Yes /classes/Product.php:4504
761
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
0.487 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
682
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 200
ORDER BY `position`
0.486 ms 1 Yes /classes/Product.php:3545
46
SELECT SQL_NO_CACHE format
FROM `mangayo_address_format`
WHERE `id_country` = 10 LIMIT 1
0.485 ms 1 /classes/AddressFormat.php:656
986
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (731) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.485 ms 1 Yes Yes /classes/Product.php:4504
1022
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7624) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.484 ms 1 Yes Yes /classes/Product.php:4504
72
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `from` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
0.483 ms 1 /classes/SpecificPrice.php:377
686
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 202
ORDER BY `position`
0.482 ms 1 Yes /classes/Product.php:3545
1087
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 16 AND `id_shop` = 1
0.480 ms 1 /src/Adapter/EntityMapper.php:79
123
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 288
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.480 ms 1 /classes/SpecificPrice.php:259
413
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 904)
0.479 ms 1 /classes/Product.php:3857
621
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7624
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.479 ms 1 /classes/SpecificPrice.php:259
9
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.478 ms 1 /classes/ObjectModel.php:1729
341
SELECT SQL_NO_CACHE *
FROM `mangayo_category_lang`
WHERE `id_category` = 11 AND `id_shop` = 1
0.477 ms 1 /src/Adapter/EntityMapper.php:79
1010
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4176) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.477 ms 1 Yes Yes /classes/Product.php:4504
1078
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.477 ms 1 /classes/Smarty/SmartyCustom.php:265
1115
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.477 ms 1 /classes/Smarty/SmartyCustom.php:265
1102
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 15) LIMIT 1
0.476 ms 1 /src/Adapter/EntityMapper.php:71
1091
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 1 AND `id_shop` = 1
0.475 ms 1 /src/Adapter/EntityMapper.php:79
83
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.474 ms 1 /classes/stock/StockAvailable.php:453
941
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.474 ms 1 /modules/an_wishlist/classes/an_wish.php:76
117
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.473 ms 1 /classes/stock/StockAvailable.php:453
989
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.472 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1080
SELECT SQL_NO_CACHE lb.`id_link_block`
FROM mangayo_link_block lb
INNER JOIN mangayo_link_block_shop lbs ON lbs.`id_link_block` = lb.`id_link_block`
WHERE lb. `id_hook` = 35 AND lbs.`id_shop` = 1
ORDER by lbs.`position`
0.472 ms 4 Yes /modules/ps_linklist/src/LegacyLinkBlockRepository.php:87
30
SELECT SQL_NO_CACHE *
FROM `mangayo_group_lang`
WHERE `id_group` = 1
0.469 ms 1 /src/Adapter/EntityMapper.php:79
372
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "spsearchpro" LIMIT 1
0.469 ms 0 /classes/module/Module.php:2636
887
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 199
ORDER BY `position`
0.469 ms 1 Yes /classes/Product.php:3545
964
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 729)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.469 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
893
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.467 ms 1 /modules/an_wishlist/classes/an_wish.php:76
73
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `to` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
0.467 ms 1 /classes/SpecificPrice.php:381
378
SELECT SQL_NO_CACHE *
FROM `mangayo_product_lang`
WHERE `id_product` = 12211 AND `id_shop` = 1
0.466 ms 1 /src/Adapter/EntityMapper.php:79
553
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.466 ms 1 /classes/Product.php:5639
684
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 201
ORDER BY `position`
0.466 ms 1 Yes /classes/Product.php:3545
27
SELECT SQL_NO_CACHE *
FROM `mangayo_currency_lang`
WHERE `id_currency` = 1
0.465 ms 1 /src/Adapter/EntityMapper.php:79
1099
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 10 AND `id_shop` = 1
0.464 ms 1 /src/Adapter/EntityMapper.php:79
889
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 199
0.463 ms 1 /classes/Product.php:2902
601
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 766)
0.462 ms 1 /classes/Product.php:3857
839
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 194
ORDER BY `position`
0.462 ms 1 Yes /classes/Product.php:3545
70
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE id_product = 0 LIMIT 1
0.460 ms 1 /classes/SpecificPrice.php:426
844
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 195)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.460 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
60
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='compile' LIMIT 1
0.460 ms 1 /classes/Smarty/SmartyCustom.php:96
491
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 199)
0.459 ms 1 /classes/Product.php:3857
820
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 98)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.459 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
832
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 194)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.459 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
678
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 198
ORDER BY `position`
0.458 ms 1 Yes /classes/Product.php:3545
694
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 729
ORDER BY `position`
0.457 ms 1 Yes /classes/Product.php:3545
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 289 AND id_shop=1 LIMIT 1
0.456 ms 1 /classes/Product.php:6848
1031
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7624
ORDER BY `position`
0.455 ms 1 Yes /classes/Product.php:3545
36
SELECT SQL_NO_CACHE * FROM `mangayo_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.455 ms 1 /classes/module/Module.php:2018
1024
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7624)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.455 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
464
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 197
AND image_shop.`cover` = 1 LIMIT 1
0.454 ms 1 /classes/Product.php:3570
20
SELECT SQL_NO_CACHE * FROM `mangayo_currency` c ORDER BY `iso_code` ASC
0.453 ms 1 Yes /classes/Currency.php:709
544
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 205
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.453 ms 1 /classes/SpecificPrice.php:259
892
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 200)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.453 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
952
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 728)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.453 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
663
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5967
ORDER BY `position`
0.452 ms 1 Yes /classes/Product.php:3545
170
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 292 AND id_shop=1 LIMIT 1
0.451 ms 1 /classes/Product.php:6848
634
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 890)
0.451 ms 1 /classes/Product.php:3857
458
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 195)
0.450 ms 1 /classes/Product.php:3857
710
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1068
ORDER BY `position`
0.450 ms 1 Yes /classes/Product.php:3545
1109
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme" LIMIT 1
0.450 ms 1 /classes/Smarty/SmartyCustom.php:216
50
SELECT SQL_NO_CACHE *
FROM `mangayo_country_lang`
WHERE `id_country` = 10
0.449 ms 1 /src/Adapter/EntityMapper.php:79
21
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.449 ms 1 /classes/Language.php:883
447
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 194)
0.449 ms 1 /classes/Product.php:3857
399
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5967
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.448 ms 1 /classes/SpecificPrice.php:259
1110
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('9b994322a10138ad46146161c46d70ed',"","charme", FROM_UNIXTIME(1719572905))
0.448 ms 1 /classes/Smarty/SmartyCustom.php:265
81
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 284 AND `id_group` = 1 LIMIT 1
0.447 ms 0 /classes/GroupReduction.php:156
879
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 199
0.447 ms 2 /classes/Product.php:3423
928
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 204)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.447 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
657
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1068)
0.447 ms 1 /classes/Product.php:3857
612
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4176)
0.446 ms 1 /classes/Product.php:3857
692
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 728
ORDER BY `position`
0.446 ms 1 Yes /classes/Product.php:3545
138
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 289 AND `id_group` = 1 LIMIT 1
0.446 ms 0 /classes/GroupReduction.php:156
1060
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1068)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.445 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
401
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5967)
0.445 ms 1 /classes/Product.php:3857
856
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 197)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.445 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
880
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 199)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.445 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
733
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php'
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme"
0.444 ms 1 /classes/Smarty/SmartyCustom.php:184
48
SELECT SQL_NO_CACHE *
FROM `mangayo_state` a
WHERE (a.`id_state` = 211) LIMIT 1
0.444 ms 1 /src/Adapter/EntityMapper.php:71
676
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 197
ORDER BY `position`
0.444 ms 1 Yes /classes/Product.php:3545
916
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 202)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.444 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
988
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 731)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.444 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
784
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5967)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.443 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
796
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 904)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.443 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
143
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.442 ms 1 /classes/Product.php:5639
253
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.442 ms 1 /classes/Product.php:5639
1048
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 37, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1018)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.442 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 289) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.441 ms 1 /classes/stock/StockAvailable.php:453
672
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 194
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
68
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.440 ms 1 /classes/Product.php:5639
670
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 98
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
1019
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4176
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
47
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.439 ms 1 /classes/Country.php:402
366
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "jmsajaxsearch" LIMIT 1
0.439 ms 0 /classes/module/Module.php:2636
757
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php'
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
0.439 ms 1 /classes/Smarty/SmartyCustom.php:184
868
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 198)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.439 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1130
INSERT IGNORE INTO `mangayo_connections_page` (`id_connections`, `id_page`, `time_start`) VALUES ('7334481', '48', '2024-06-28 13:08:25')
0.439 ms 1 /classes/Connection.php:122
23
SELECT SQL_NO_CACHE c.id_currency
FROM `mangayo_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.438 ms 1 /classes/Currency.php:893
3
SELECT SQL_NO_CACHE *
FROM `mangayo_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.438 ms 1 /src/Adapter/EntityMapper.php:71
375
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "payplug" LIMIT 1
0.438 ms 1 /classes/module/Module.php:2636
472
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 197) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.438 ms 1 /classes/stock/StockAvailable.php:453
674
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 195
ORDER BY `position`
0.437 ms 1 Yes /classes/Product.php:3545
885
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 199) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.437 ms 1 /classes/stock/StockAvailable.php:806
904
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 201)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.437 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1096
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 9) LIMIT 1
0.437 ms 1 /src/Adapter/EntityMapper.php:71
1127
SELECT SQL_NO_CACHE id_page_type
FROM mangayo_page_type
WHERE name = 'category' LIMIT 1
0.437 ms 1 /classes/Page.php:104
708
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1018
ORDER BY `position`
0.436 ms 1 Yes /classes/Product.php:3545
1000
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 766)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.436 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
32
SELECT SQL_NO_CACHE ctg.`id_group`
FROM mangayo_category_group ctg
WHERE ctg.`id_category` = 11 AND ctg.`id_group` = 1 LIMIT 1
0.435 ms 1 /classes/Category.php:1751
43
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.435 ms 0 /classes/module/Module.php:2636
732
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('4a4b03e34f9266c4e082efcc7a2e039e',"","charme", FROM_UNIXTIME(1719572904))
0.435 ms 1 /classes/Smarty/SmartyCustom.php:265
935
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 204
ORDER BY `position`
0.435 ms 1 Yes /classes/Product.php:3545
159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 291 AND id_shop=1 LIMIT 1
0.434 ms 1 /classes/Product.php:6848
500
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 200
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.434 ms 1 /classes/SpecificPrice.php:259
976
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 730)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.434 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
422
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 97
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.433 ms 1 /classes/SpecificPrice.php:259
607
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4176
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
704
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7624
ORDER BY `position`
0.433 ms 1 Yes /classes/Product.php:3545
1036
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 890)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.433 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
127
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 288 AND `id_group` = 1 LIMIT 1
0.432 ms 0 /classes/GroupReduction.php:156
172
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.432 ms 1 /classes/stock/StockAvailable.php:453
203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 295 AND id_shop=1 LIMIT 1
0.432 ms 1 /classes/Product.php:6848
629
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 890
AND image_shop.`cover` = 1 LIMIT 1
0.432 ms 1 /classes/Product.php:3570
1123
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_widgets` sw
LEFT JOIN `mangayo_an_trust_badges_widgets_lang` sl 
ON (sw.`id_widget` = sl.`id_widget`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1 
AND sw.`hook`="displayCopyrightContainer"
0.432 ms 2 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php:86
56
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_productcomments" LIMIT 1
0.431 ms 0 /classes/module/Module.php:2636
238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.431 ms 1 /classes/stock/StockAvailable.php:453
808
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 97)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.431 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.430 ms 1 /classes/stock/StockAvailable.php:453
116
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 287 AND `id_group` = 1 LIMIT 1
0.430 ms 0 /classes/GroupReduction.php:156
165
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.430 ms 1 /classes/Product.php:5639
260
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 300) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.430 ms 1 /classes/stock/StockAvailable.php:453
1012
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4176)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.430 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
178
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.430 ms 1 /classes/SpecificPrice.php:259
255
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 300
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.430 ms 1 /classes/SpecificPrice.php:259
1104
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 23) LIMIT 1
0.429 ms 1 /src/Adapter/EntityMapper.php:71
150
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 290) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.429 ms 1 /classes/stock/StockAvailable.php:453
95
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.428 ms 1 /classes/stock/StockAvailable.php:453
211
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.428 ms 1 /classes/SpecificPrice.php:259
875
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 198
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
961
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 728
0.428 ms 1 /classes/Product.php:2902
971
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 729
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
1124
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_icons` sw
WHERE sw.`active`=1
0.428 ms 40 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php:84
1134
SELECT SQL_NO_CACHE data
FROM `mangayo_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.427 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
319
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.426 ms 1 /classes/Product.php:5639
489
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 199
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.426 ms 1 /classes/SpecificPrice.php:259
951
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 728
0.426 ms 1 /classes/Product.php:3423
568
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 729)
0.426 ms 1 /classes/Product.php:3857
216
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.425 ms 1 /classes/stock/StockAvailable.php:453
313
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 305 AND id_shop=1 LIMIT 1
0.425 ms 1 /classes/Product.php:6848
535
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 204)
0.425 ms 1 /classes/Product.php:3857
337
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.424 ms 1 /classes/stock/StockAvailable.php:453
696
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 730
ORDER BY `position`
0.424 ms 1 Yes /classes/Product.php:3545
176
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.424 ms 1 /classes/Product.php:5639
330
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.424 ms 1 /classes/Product.php:5639
156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 291
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.423 ms 1 /classes/SpecificPrice.php:259
57
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_reviews" LIMIT 1
0.423 ms 0 /classes/module/Module.php:2636
105
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 286 AND `id_group` = 1 LIMIT 1
0.423 ms 0 /classes/GroupReduction.php:156
286
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.422 ms 1 /classes/Product.php:5639
1090
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 1) LIMIT 1
0.422 ms 1 /src/Adapter/EntityMapper.php:71
88
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.421 ms 1 /classes/Product.php:5639
121
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.421 ms 1 /classes/Product.php:5639
220
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.421 ms 1 /classes/Product.php:5639
552
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 728
AND image_shop.`cover` = 1 LIMIT 1
0.421 ms 1 /classes/Product.php:3570
666
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 904
ORDER BY `position`
0.421 ms 1 Yes /classes/Product.php:3545
132
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.421 ms 1 /classes/Product.php:5639
269
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 301 AND id_shop=1 LIMIT 1
0.421 ms 1 /classes/Product.php:6848
187
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.420 ms 1 /classes/Product.php:5639
396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5967
AND image_shop.`cover` = 1 LIMIT 1
0.420 ms 1 /classes/Product.php:3570
55
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 142 AND `id_shop` = 1 LIMIT 1
0.420 ms 0 /classes/module/Module.php:2109
93
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 285 AND id_shop=1 LIMIT 1
0.420 ms 1 /classes/Product.php:6848
475
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 198
AND image_shop.`cover` = 1 LIMIT 1
0.420 ms 1 /classes/Product.php:3570
247
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 299 AND id_shop=1 LIMIT 1
0.419 ms 1 /classes/Product.php:6848
435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 98)
0.419 ms 1 /classes/Product.php:3857
983
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 730
ORDER BY `position`
0.419 ms 1 Yes /classes/Product.php:3545
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 294 AND id_shop=1 LIMIT 1
0.418 ms 1 /classes/Product.php:6848
376
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 131 AND `id_shop` = 1 LIMIT 1
0.418 ms 1 /classes/module/Module.php:2109
618
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7624
AND image_shop.`cover` = 1 LIMIT 1
0.418 ms 1 /classes/Product.php:3570
690
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 205
ORDER BY `position`
0.418 ms 1 Yes /classes/Product.php:3545
863
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 197
ORDER BY `position`
0.417 ms 1 Yes /classes/Product.php:3545
668
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 97
ORDER BY `position`
0.417 ms 1 Yes /classes/Product.php:3545
688
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 204
ORDER BY `position`
0.417 ms 1 Yes /classes/Product.php:3545
810
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 97 LIMIT 1
0.417 ms 56 /modules/an_wishlist/classes/an_wish_products.php:124
899
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 200
ORDER BY `position`
0.417 ms 1 Yes /classes/Product.php:3545
161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 291) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.416 ms 1 /classes/stock/StockAvailable.php:453
282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.416 ms 1 /classes/stock/StockAvailable.php:453
995
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 731
ORDER BY `position`
0.416 ms 1 Yes /classes/Product.php:3545
1027
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7624) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.416 ms 1 /classes/stock/StockAvailable.php:778
270
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 301 AND `id_group` = 1 LIMIT 1
0.416 ms 0 /classes/GroupReduction.php:156
335
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 307 AND id_shop=1 LIMIT 1
0.416 ms 1 /classes/Product.php:6848
181
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 293 AND id_shop=1 LIMIT 1
0.415 ms 1 /classes/Product.php:6848
209
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.415 ms 1 /classes/Product.php:5639
698
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 731
ORDER BY `position`
0.415 ms 1 Yes /classes/Product.php:3545
1007
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 766
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
1043
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 890
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
1067
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1068
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
827
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 98
ORDER BY `position`
0.414 ms 1 Yes /classes/Product.php:3545
242
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.413 ms 1 /classes/Product.php:5639
104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 286 AND id_shop=1 LIMIT 1
0.413 ms 1 /classes/Product.php:6848
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 304 AND id_shop=1 LIMIT 1
0.413 ms 1 /classes/Product.php:6848
348
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_searchbar" LIMIT 1
0.413 ms 1 /classes/module/Module.php:2636
502
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 200)
0.413 ms 1 /classes/Product.php:3857
574
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 730
AND image_shop.`cover` = 1 LIMIT 1
0.413 ms 1 /classes/Product.php:3570
148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 290 AND id_shop=1 LIMIT 1
0.412 ms 1 /classes/Product.php:6848
264
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.412 ms 1 /classes/Product.php:5639
947
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 205
ORDER BY `position`
0.412 ms 1 Yes /classes/Product.php:3545
1092
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 19) LIMIT 1
0.412 ms 1 /src/Adapter/EntityMapper.php:71
1103
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 15 AND `id_shop` = 1
0.412 ms 1 /src/Adapter/EntityMapper.php:79
67
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 11 LIMIT 1
0.411 ms 1 /classes/Category.php:1375
214
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 296 AND id_shop=1 LIMIT 1
0.411 ms 1 /classes/Product.php:6848
222
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.411 ms 1 /classes/SpecificPrice.php:259
546
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 205)
0.411 ms 1 /classes/Product.php:3857
706
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 890
ORDER BY `position`
0.411 ms 1 Yes /classes/Product.php:3545
297
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.410 ms 1 /classes/Product.php:5639
680
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 199
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
702
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4176
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
99
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.410 ms 1 /classes/Product.php:5639
750
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
0.410 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
759
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.409 ms 1 /classes/Smarty/SmartyCustom.php:265
28
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.408 ms 1 /classes/ObjectModel.php:1729
128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 288) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.408 ms 1 /classes/stock/StockAvailable.php:453
308
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.408 ms 1 /classes/Product.php:5639
497
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 200
AND image_shop.`cover` = 1 LIMIT 1
0.408 ms 1 /classes/Product.php:3570
911
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 201
ORDER BY `position`
0.408 ms 1 Yes /classes/Product.php:3545
63
SELECT SQL_NO_CACHE * FROM `mangayo_image_type`
0.407 ms 18 /classes/ImageType.php:161
77
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 284 AND id_shop=1 LIMIT 1
0.407 ms 1 /classes/Product.php:6848
233
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.407 ms 1 /classes/SpecificPrice.php:259
288
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.407 ms 1 /classes/SpecificPrice.php:259
126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 288 AND id_shop=1 LIMIT 1
0.406 ms 1 /classes/Product.php:6848
236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 298 AND id_shop=1 LIMIT 1
0.406 ms 1 /classes/Product.php:6848
280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 302 AND id_shop=1 LIMIT 1
0.406 ms 1 /classes/Product.php:6848
803
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 904
ORDER BY `position`
0.406 ms 1 Yes /classes/Product.php:3545
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 294) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.405 ms 1 /classes/stock/StockAvailable.php:453
524
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 202)
0.405 ms 1 /classes/Product.php:3857
145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 290
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.405 ms 1 /classes/SpecificPrice.php:259
1098
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 10) LIMIT 1
0.404 ms 1 /src/Adapter/EntityMapper.php:71
115
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 287 AND id_shop=1 LIMIT 1
0.404 ms 1 /classes/Product.php:6848
1055
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1018
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3545
51
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM mangayo_required_field
0.403 ms 1 /classes/ObjectModel.php:1592
530
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 204
AND image_shop.`cover` = 1 LIMIT 1
0.403 ms 1 /classes/Product.php:3570
1013
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.402 ms 1 /modules/an_wishlist/classes/an_wish.php:76
53
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_homecategories" LIMIT 1
0.402 ms 0 /classes/module/Module.php:2636
231
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.402 ms 1 /classes/Product.php:5639
487
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.402 ms 1 /classes/Product.php:5639
596
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 766
AND image_shop.`cover` = 1 LIMIT 1
0.402 ms 1 /classes/Product.php:3570
700
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 766
ORDER BY `position`
0.402 ms 1 Yes /classes/Product.php:3545
765
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
0.402 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
923
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 202
ORDER BY `position`
0.402 ms 1 Yes /classes/Product.php:3545
183
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.401 ms 1 /classes/stock/StockAvailable.php:453
101
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.400 ms 1 /classes/SpecificPrice.php:259
258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 300 AND id_shop=1 LIMIT 1
0.400 ms 1 /classes/Product.php:6848
805
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 904
0.400 ms 1 /classes/Product.php:2902
851
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 195
ORDER BY `position`
0.400 ms 1 Yes /classes/Product.php:3545
959
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 728
ORDER BY `position`
0.400 ms 1 Yes /classes/Product.php:3545
585
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 731
AND image_shop.`cover` = 1 LIMIT 1
0.400 ms 1 /classes/Product.php:3570
25
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.399 ms 1 /classes/Language.php:883
61
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.399 ms 0 /classes/module/Module.php:2636
419
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 97
AND image_shop.`cover` = 1 LIMIT 1
0.399 ms 1 /classes/Product.php:3570
744
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572904))
0.399 ms 1 /classes/Smarty/SmartyCustom.php:265
215
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 296 AND `id_group` = 1 LIMIT 1
0.399 ms 0 /classes/GroupReduction.php:156
791
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5967
ORDER BY `position`
0.398 ms 1 Yes /classes/Product.php:3545
1084
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 6
0.398 ms 1 /src/Adapter/EntityMapper.php:79
275
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.397 ms 1 /classes/Product.php:5639
515
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 201 AND `id_group` = 1 LIMIT 1
0.397 ms 0 /classes/GroupReduction.php:156
677
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 197
0.397 ms 1 /classes/Product.php:2902
772
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php'
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
0.397 ms 1 /classes/Smarty/SmartyCustom.php:184
841
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 194
0.397 ms 1 /classes/Product.php:2902
1119
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_copyright" LIMIT 1
0.397 ms 1 /classes/module/Module.php:2636
110
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.396 ms 1 /classes/Product.php:5639
407
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 904
AND image_shop.`cover` = 1 LIMIT 1
0.396 ms 1 /classes/Product.php:3570
815
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 97
ORDER BY `position`
0.396 ms 1 Yes /classes/Product.php:3545
271
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 301) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.395 ms 1 /classes/stock/StockAvailable.php:453
299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.395 ms 1 /classes/SpecificPrice.php:259
346
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 14 LIMIT 1
0.395 ms 1 /classes/Hook.php:244
430
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 98
AND image_shop.`cover` = 1 LIMIT 1
0.395 ms 1 /classes/Product.php:3570
555
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 728
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.395 ms 1 /classes/SpecificPrice.php:259
1100
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 11) LIMIT 1
0.395 ms 1 /src/Adapter/EntityMapper.php:71
712
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_theme" LIMIT 1
0.395 ms 1 /classes/module/Module.php:2636
227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.394 ms 1 /classes/stock/StockAvailable.php:453
353
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.394 ms 0 /classes/module/Module.php:2109
557
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 728)
0.394 ms 1 /classes/Product.php:3857
90
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.394 ms 1 /classes/SpecificPrice.php:259
315
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.394 ms 1 /classes/stock/StockAvailable.php:453
453
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 195
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
508
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 201
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
371
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.393 ms 0 /classes/module/Module.php:2109
345
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.392 ms 0 /classes/module/Module.php:2636
652
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1068
AND image_shop.`cover` = 1 LIMIT 1
0.392 ms 1 /classes/Product.php:3570
693
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 728
0.392 ms 1 /classes/Product.php:2902
1112
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customeraccountlinks" LIMIT 1
0.392 ms 1 /classes/module/Module.php:2636
586
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.391 ms 1 /classes/Product.php:5639
640
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1018
AND image_shop.`cover` = 1 LIMIT 1
0.391 ms 1 /classes/Product.php:3570
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:453
356
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ttblocksearch" LIMIT 1
0.390 ms 0 /classes/module/Module.php:2636
486
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 199
AND image_shop.`cover` = 1 LIMIT 1
0.390 ms 1 /classes/Product.php:3570
931
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 204) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:778
1072
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_contactinfo" LIMIT 1
0.390 ms 1 /classes/module/Module.php:2636
1085
SELECT SQL_NO_CACHE *
FROM `mangayo_hook` a
WHERE (a.`id_hook` = 35) LIMIT 1
0.390 ms 1 /src/Adapter/EntityMapper.php:71
1088
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) LIMIT 1
0.390 ms 1 /src/Adapter/EntityMapper.php:71
324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 306 AND id_shop=1 LIMIT 1
0.389 ms 1 /classes/Product.php:6848
336
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 307 AND `id_group` = 1 LIMIT 1
0.389 ms 0 /classes/GroupReduction.php:156
357
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.389 ms 0 /classes/module/Module.php:2109
1086
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 16) LIMIT 1
0.389 ms 1 /src/Adapter/EntityMapper.php:71
687
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 202
0.388 ms 1 /classes/Product.php:2902
249
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.388 ms 1 /classes/stock/StockAvailable.php:453
281
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 302 AND `id_group` = 1 LIMIT 1
0.388 ms 0 /classes/GroupReduction.php:156
326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.388 ms 1 /classes/stock/StockAvailable.php:453
593
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 731) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.388 ms 1 /classes/stock/StockAvailable.php:453
814
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 97 LIMIT 1
0.388 ms 1 /classes/Product.php:1106
591
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 731 AND id_shop=1 LIMIT 1
0.387 ms 1 /classes/Product.php:6848
834
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 194 LIMIT 1
0.387 ms 218 /modules/an_wishlist/classes/an_wish_products.php:124
1116
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.387 ms 1 /classes/Smarty/SmartyCustom.php:265
205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.386 ms 1 /classes/stock/StockAvailable.php:453
248
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 299 AND `id_group` = 1 LIMIT 1
0.386 ms 0 /classes/GroupReduction.php:156
360
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labsearch" LIMIT 1
0.386 ms 0 /classes/module/Module.php:2636
362
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tvcmssearch" LIMIT 1
0.386 ms 0 /classes/module/Module.php:2636
509
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.386 ms 1 /classes/Product.php:5639
511
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 201
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.386 ms 1 /classes/SpecificPrice.php:259
1030
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7624 LIMIT 1
0.386 ms 1 /classes/Product.php:1106
94
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 285 AND `id_group` = 1 LIMIT 1
0.385 ms 0 /classes/GroupReduction.php:156
198
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.385 ms 1 /classes/Product.php:5639
321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.385 ms 1 /classes/SpecificPrice.php:259
354
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tmsearch" LIMIT 1
0.385 ms 0 /classes/module/Module.php:2636
711
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1068
0.385 ms 1 /classes/Product.php:2902
1015
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.385 ms 1 /classes/stock/StockAvailable.php:778
1081
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
62
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "btfacebookchats" LIMIT 1
0.384 ms 0 /classes/module/Module.php:2636
189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 294
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.383 ms 1 /classes/SpecificPrice.php:259
293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:453
380
SELECT SQL_NO_CACHE e.`id_product` as id
FROM `mangayo_product` e
WHERE (e.`id_product` = 12211) LIMIT 1
0.383 ms 1 /classes/ObjectModel.php:2029
277
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.382 ms 1 /classes/SpecificPrice.php:259
685
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 201
0.382 ms 1 /classes/Product.php:2902
134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 289
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.382 ms 1 /classes/SpecificPrice.php:259
171
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 292 AND `id_group` = 1 LIMIT 1
0.382 ms 0 /classes/GroupReduction.php:156
303
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 304 AND `id_group` = 1 LIMIT 1
0.382 ms 0 /classes/GroupReduction.php:156
149
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 290 AND `id_group` = 1 LIMIT 1
0.381 ms 0 /classes/GroupReduction.php:156
860
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 197) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.381 ms 1 /classes/stock/StockAvailable.php:753
929
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.381 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1079
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.381 ms 1 /classes/Smarty/SmartyCustom.php:265
167
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 292
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.380 ms 1 /classes/SpecificPrice.php:259
519
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 202
AND image_shop.`cover` = 1 LIMIT 1
0.380 ms 1 /classes/Product.php:3570
667
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 904
0.380 ms 1 /classes/Product.php:2902
1038
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 890 LIMIT 1
0.380 ms 89 /modules/an_wishlist/classes/an_wish_products.php:124
200
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.379 ms 1 /classes/SpecificPrice.php:259
226
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 297 AND `id_group` = 1 LIMIT 1
0.379 ms 0 /classes/GroupReduction.php:156
845
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.379 ms 1 /modules/an_wishlist/classes/an_wish.php:76
862
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 197 LIMIT 1
0.379 ms 1 /classes/Product.php:1106
949
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 205
0.378 ms 1 /classes/Product.php:2902
237
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 298 AND `id_group` = 1 LIMIT 1
0.378 ms 0 /classes/GroupReduction.php:156
314
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 305 AND `id_group` = 1 LIMIT 1
0.378 ms 0 /classes/GroupReduction.php:156
538
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 204) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.378 ms 1 /classes/stock/StockAvailable.php:453
730
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='template' LIMIT 1
0.378 ms 1 /classes/Smarty/SmartyCustom.php:143
244
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.377 ms 1 /classes/SpecificPrice.php:259
367
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.377 ms 0 /classes/module/Module.php:2109
566
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 729
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.377 ms 1 /classes/SpecificPrice.php:259
714
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
0.377 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
958
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 728 LIMIT 1
0.377 ms 1 /classes/Product.php:1106
783
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5967
0.376 ms 3 /classes/Product.php:3423
930
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 204 LIMIT 1
0.376 ms 93 /modules/an_wishlist/classes/an_wish_products.php:124
1062
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1068 LIMIT 1
0.376 ms 71 /modules/an_wishlist/classes/an_wish_products.php:124
1122
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 150 AND `id_shop` = 1 LIMIT 1
0.376 ms 1 /classes/module/Module.php:2109
291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 303 AND id_shop=1 LIMIT 1
0.375 ms 1 /classes/Product.php:6848
850
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 195 LIMIT 1
0.375 ms 1 /classes/Product.php:1106
859
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 197) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:778
910
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 201 LIMIT 1
0.375 ms 1 /classes/Product.php:1106
987
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 731
0.375 ms 1 /classes/Product.php:3423
1114
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme" LIMIT 1
0.375 ms 1 /classes/Smarty/SmartyCustom.php:216
112
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.375 ms 1 /classes/SpecificPrice.php:259
809
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.375 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1083
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 6) LIMIT 1
0.375 ms 1 /src/Adapter/EntityMapper.php:71
204
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 295 AND `id_group` = 1 LIMIT 1
0.374 ms 0 /classes/GroupReduction.php:156
541
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 205
AND image_shop.`cover` = 1 LIMIT 1
0.374 ms 1 /classes/Product.php:3570
855
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 197
0.374 ms 2 /classes/Product.php:3423
946
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 205 LIMIT 1
0.374 ms 1 /classes/Product.php:1106
602
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 766 AND id_shop=1 LIMIT 1
0.374 ms 1 /classes/Product.php:6848
819
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 98
0.374 ms 2 /classes/Product.php:3423
826
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 98 LIMIT 1
0.374 ms 1 /classes/Product.php:1106
1018
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4176 LIMIT 1
0.374 ms 1 /classes/Product.php:1106
225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 297 AND id_shop=1 LIMIT 1
0.373 ms 1 /classes/Product.php:6848
266
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 301
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.373 ms 1 /classes/SpecificPrice.php:259
363
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.373 ms 0 /classes/module/Module.php:2109
494
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 199) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
351
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.373 ms 0 /classes/module/Module.php:2109
797
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.372 ms 1 /modules/an_wishlist/classes/an_wish.php:76
615
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:453
785
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.372 ms 1 /modules/an_wishlist/classes/an_wish.php:76
801
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 904) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:806
802
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 904 LIMIT 1
0.372 ms 1 /classes/Product.php:1106
1050
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1018 LIMIT 1
0.372 ms 170 /modules/an_wishlist/classes/an_wish_products.php:124
1094
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 8) LIMIT 1
0.372 ms 1 /src/Adapter/EntityMapper.php:71
723
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `mangayo_currency` c
LEFT JOIN mangayo_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.371 ms 1 /classes/Currency.php:1136
1054
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1018 LIMIT 1
0.371 ms 1 /classes/Product.php:1106
1066
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1068 LIMIT 1
0.371 ms 1 /classes/Product.php:1106
82
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_group`
WHERE `id_group` = 1 LIMIT 1
0.370 ms 1 /classes/Group.php:154
536
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 204 AND id_shop=1 LIMIT 1
0.370 ms 1 /classes/Product.php:6848
886
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 199 LIMIT 1
0.370 ms 1 /classes/Product.php:1106
982
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 730 LIMIT 1
0.370 ms 1 /classes/Product.php:1106
990
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 731 LIMIT 1
0.370 ms 53 /modules/an_wishlist/classes/an_wish_products.php:124
1006
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 766 LIMIT 1
0.370 ms 1 /classes/Product.php:1106
1025
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.370 ms 1 /modules/an_wishlist/classes/an_wish.php:76
441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 194
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
731
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme" LIMIT 1
0.369 ms 0 /classes/Smarty/SmartyCustom.php:216
857
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.369 ms 1 /modules/an_wishlist/classes/an_wish.php:76
870
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 198 LIMIT 1
0.369 ms 85 /modules/an_wishlist/classes/an_wish_products.php:124
364
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "stsearchbar" LIMIT 1
0.369 ms 0 /classes/module/Module.php:2636
1073
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 12 AND `id_shop` = 1 LIMIT 1
0.369 ms 1 /classes/module/Module.php:2109
332
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.368 ms 1 /classes/SpecificPrice.php:259
369
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.368 ms 0 /classes/module/Module.php:2109
843
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 195
0.368 ms 2 /classes/Product.php:3423
1106
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.368 ms 1 /classes/Smarty/SmartyCustom.php:265
563
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 729
AND image_shop.`cover` = 1 LIMIT 1
0.368 ms 1 /classes/Product.php:3570
822
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 98 LIMIT 1
0.368 ms 23 /modules/an_wishlist/classes/an_wish_products.php:124
1113
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 14 AND `id_shop` = 1 LIMIT 1
0.368 ms 1 /classes/module/Module.php:2109
549
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 205) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.367 ms 1 /classes/stock/StockAvailable.php:453
1120
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 148 AND `id_shop` = 1 LIMIT 1
0.366 ms 1 /classes/module/Module.php:2109
182
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 293 AND `id_group` = 1 LIMIT 1
0.366 ms 0 /classes/GroupReduction.php:156
426
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 97 AND `id_group` = 1 LIMIT 1
0.366 ms 0 /classes/GroupReduction.php:156
1042
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 890 LIMIT 1
0.366 ms 1 /classes/Product.php:1106
1049
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.366 ms 1 /modules/an_wishlist/classes/an_wish.php:76
570
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 729 AND `id_group` = 1 LIMIT 1
0.365 ms 0 /classes/GroupReduction.php:156
580
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 730 AND id_shop=1 LIMIT 1
0.365 ms 1 /classes/Product.php:6848
786
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5967 LIMIT 1
0.365 ms 4 /modules/an_wishlist/classes/an_wish_products.php:124
896
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.365 ms 1 /classes/stock/StockAvailable.php:753
1082
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 1
0.365 ms 1 /src/Adapter/EntityMapper.php:79
877
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 198
0.364 ms 1 /classes/Product.php:2902
310
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.363 ms 1 /classes/SpecificPrice.php:259
352
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "blocksearch_mod" LIMIT 1
0.363 ms 0 /classes/module/Module.php:2636
942
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 205 LIMIT 1
0.363 ms 97 /modules/an_wishlist/classes/an_wish_products.php:124
655
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1068
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 1 /classes/SpecificPrice.php:259
1121
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_trust_badges" LIMIT 1
0.362 ms 1 /classes/module/Module.php:2636
448
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 194 AND id_shop=1 LIMIT 1
0.361 ms 1 /classes/Product.php:6848
349
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 25 AND `id_shop` = 1 LIMIT 1
0.361 ms 1 /classes/module/Module.php:2109
373
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.361 ms 0 /classes/module/Module.php:2109
703
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4176
0.361 ms 1 /classes/Product.php:2902
898
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 200 LIMIT 1
0.361 ms 1 /classes/Product.php:1106
368
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "bonsearch" LIMIT 1
0.360 ms 0 /classes/module/Module.php:2636
379
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 2 LIMIT 1
0.360 ms 0 /classes/Category.php:1375
906
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 201 LIMIT 1
0.360 ms 87 /modules/an_wishlist/classes/an_wish_products.php:124
918
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 202 LIMIT 1
0.360 ms 85 /modules/an_wishlist/classes/an_wish_products.php:124
292
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 303 AND `id_group` = 1 LIMIT 1
0.359 ms 0 /classes/GroupReduction.php:156
979
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 730) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.359 ms 1 /classes/stock/StockAvailable.php:778
738
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.359 ms 1 /modules/an_wishlist/classes/an_wish.php:76
994
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 731 LIMIT 1
0.359 ms 1 /classes/Product.php:1106
894
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 200 LIMIT 1
0.358 ms 83 /modules/an_wishlist/classes/an_wish_products.php:124
436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 98 AND id_shop=1 LIMIT 1
0.358 ms 1 /classes/Product.php:6848
881
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.358 ms 1 /modules/an_wishlist/classes/an_wish.php:76
966
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 729 LIMIT 1
0.358 ms 65 /modules/an_wishlist/classes/an_wish_products.php:124
997
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 731
0.358 ms 1 /classes/Product.php:2902
1035
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 890
0.358 ms 2 /classes/Product.php:3423
1052
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.357 ms 1 /classes/stock/StockAvailable.php:753
604
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.356 ms 1 /classes/stock/StockAvailable.php:453
913
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 201
0.356 ms 1 /classes/Product.php:2902
361
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.355 ms 0 /classes/module/Module.php:2109
370
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tdsearchblock" LIMIT 1
0.355 ms 0 /classes/module/Module.php:2636
470
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 197 AND id_shop=1 LIMIT 1
0.355 ms 1 /classes/Product.php:6848
637
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 890) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.355 ms 1 /classes/stock/StockAvailable.php:453
869
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.355 ms 1 /modules/an_wishlist/classes/an_wish.php:76
978
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 730 LIMIT 1
0.355 ms 60 /modules/an_wishlist/classes/an_wish_products.php:124
259
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 300 AND `id_group` = 1 LIMIT 1
0.354 ms 0 /classes/GroupReduction.php:156
449
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 194 AND `id_group` = 1 LIMIT 1
0.354 ms 0 /classes/GroupReduction.php:156
548
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 205 AND `id_group` = 1 LIMIT 1
0.354 ms 0 /classes/GroupReduction.php:156
577
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 730
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.354 ms 1 /classes/SpecificPrice.php:259
1002
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 766 LIMIT 1
0.354 ms 80 /modules/an_wishlist/classes/an_wish_products.php:124
350
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "leoproductsearch" LIMIT 1
0.354 ms 0 /classes/module/Module.php:2636
359
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.354 ms 0 /classes/module/Module.php:2109
699
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 731
0.353 ms 1 /classes/Product.php:2902
719
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.353 ms 1 /classes/module/Module.php:2636
934
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 204 LIMIT 1
0.353 ms 1 /classes/Product.php:1106
342
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 11) LIMIT 1
0.353 ms 1 /classes/Category.php:1971
614
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4176 AND `id_group` = 1 LIMIT 1
0.353 ms 0 /classes/GroupReduction.php:156
970
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 729 LIMIT 1
0.353 ms 1 /classes/Product.php:1106
355
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.352 ms 0 /classes/module/Module.php:2109
660
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.352 ms 1 /classes/stock/StockAvailable.php:453
728
SELECT SQL_NO_CACHE *
FROM `mangayo_dark_mode` a
WHERE (a.`id` = 1) LIMIT 1
0.352 ms 1 /src/Adapter/EntityMapper.php:71
325
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 306 AND `id_group` = 1 LIMIT 1
0.352 ms 0 /classes/GroupReduction.php:156
953
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.352 ms 1 /modules/an_wishlist/classes/an_wish.php:76
968
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 729) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.351 ms 1 /classes/stock/StockAvailable.php:753
973
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 729
0.351 ms 1 /classes/Product.php:2902
358
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labblocksearch" LIMIT 1
0.350 ms 0 /classes/module/Module.php:2636
397
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.350 ms 1 /classes/Product.php:5639
431
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.350 ms 1 /classes/Product.php:5639
874
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 198 LIMIT 1
0.350 ms 1 /classes/Product.php:1106
919
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 202) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:778
943
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 205) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:778
1065
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:806
1075
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_linklist" LIMIT 1
0.350 ms 1 /classes/module/Module.php:2636
1077
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme" LIMIT 1
0.350 ms 0 /classes/Smarty/SmartyCustom.php:216
365
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.349 ms 0 /classes/module/Module.php:2109
721
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.349 ms 1 /classes/module/Module.php:2636
813
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 97) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.349 ms 1 /classes/stock/StockAvailable.php:806
817
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 97
0.349 ms 1 /classes/Product.php:2902
838
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 194 LIMIT 1
0.349 ms 1 /classes/Product.php:1106
897
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.349 ms 1 /classes/stock/StockAvailable.php:806
922
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 202 LIMIT 1
0.349 ms 1 /classes/Product.php:1106
1074
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.349 ms 1 /classes/Country.php:402
444
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 6
AND `active` = 1 LIMIT 1
0.348 ms 1 /classes/Manufacturer.php:316
450
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
582
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 730) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
343
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 2) LIMIT 1
0.348 ms 1 /classes/Category.php:1971
742
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.348 ms 1 /classes/module/Module.php:2109
793
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5967
0.348 ms 1 /classes/Product.php:2902
569
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 729 AND id_shop=1 LIMIT 1
0.347 ms 1 /classes/Product.php:6848
608
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.347 ms 1 /classes/Product.php:5639
649
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.347 ms 1 /classes/stock/StockAvailable.php:453
835
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.347 ms 1 /classes/stock/StockAvailable.php:778
985
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 730
0.347 ms 1 /classes/Product.php:2902
1037
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.347 ms 1 /modules/an_wishlist/classes/an_wish.php:76
571
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 729) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.347 ms 1 /classes/stock/StockAvailable.php:453
630
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.347 ms 1 /classes/Product.php:5639
691
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 205
0.346 ms 1 /classes/Product.php:2902
404
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5967) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:453
560
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:453
709
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1018
0.346 ms 1 /classes/Product.php:2902
760
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.346 ms 1 /classes/Smarty/SmartyCustom.php:265
778
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 10 AND `id_shop` = 1 LIMIT 1
0.346 ms 1 /classes/module/Module.php:2109
787
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5967) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:778
955
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:778
415
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 904 AND `id_group` = 1 LIMIT 1
0.345 ms 0 /classes/GroupReduction.php:156
558
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 728 AND id_shop=1 LIMIT 1
0.345 ms 1 /classes/Product.php:6848
610
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4176
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.345 ms 1 /classes/SpecificPrice.php:259
689
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 204
0.345 ms 1 /classes/Product.php:2902
734
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.345 ms 1 /classes/module/Module.php:2636
790
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5967 LIMIT 1
0.345 ms 1 /classes/Product.php:1106
883
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 199) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.345 ms 1 /classes/stock/StockAvailable.php:778
907
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 201) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.345 ms 1 /classes/stock/StockAvailable.php:778
193
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 294 AND `id_group` = 1 LIMIT 1
0.344 ms 0 /classes/GroupReduction.php:156
408
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.344 ms 1 /classes/Product.php:5639
454
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.344 ms 1 /classes/Product.php:5639
592
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 731 AND `id_group` = 1 LIMIT 1
0.344 ms 0 /classes/GroupReduction.php:156
653
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.344 ms 1 /classes/Product.php:5639
725
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 147 AND `id_shop` = 1 LIMIT 1
0.344 ms 1 /classes/module/Module.php:2109
740
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.344 ms 1 /classes/module/Module.php:2109
798
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 904 LIMIT 1
0.344 ms 48 /modules/an_wishlist/classes/an_wish_products.php:124
836
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:753
873
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 198) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:806
905
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.344 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1001
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.344 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1070
SELECT SQL_NO_CACHE *
FROM `mangayo_image_type` a
WHERE (a.`id_image_type` = 14) LIMIT 1
0.344 ms 1 /src/Adapter/EntityMapper.php:71
915
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 202
0.344 ms 2 /classes/Product.php:3423
476
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.343 ms 1 /classes/Product.php:5639
581
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 730 AND `id_group` = 1 LIMIT 1
0.343 ms 0 /classes/GroupReduction.php:156
846
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 195 LIMIT 1
0.343 ms 78 /modules/an_wishlist/classes/an_wish_products.php:124
520
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.343 ms 1 /classes/Product.php:5639
954
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 728 LIMIT 1
0.343 ms 92 /modules/an_wishlist/classes/an_wish_products.php:124
504
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 200 AND `id_group` = 1 LIMIT 1
0.342 ms 0 /classes/GroupReduction.php:156
701
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 766
0.342 ms 1 /classes/Product.php:2902
743
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
0.342 ms 0 /classes/Smarty/SmartyCustom.php:216
758
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
0.342 ms 0 /classes/Smarty/SmartyCustom.php:216
1003
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.342 ms 1 /classes/stock/StockAvailable.php:778
901
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 200
0.342 ms 1 /classes/Product.php:2902
1061
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.342 ms 1 /modules/an_wishlist/classes/an_wish.php:76
695
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 729
0.341 ms 1 /classes/Product.php:2902
741
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_logo" LIMIT 1
0.341 ms 1 /classes/module/Module.php:2636
533
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 204
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.341 ms 1 /classes/SpecificPrice.php:259
705
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7624
0.341 ms 1 /classes/Product.php:2902
799
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 904) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:778
956
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:753
467
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 197
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.340 ms 1 /classes/SpecificPrice.php:259
675
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 195
0.340 ms 1 /classes/Product.php:2902
683
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 200
0.340 ms 1 /classes/Product.php:2902
833
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.340 ms 1 /modules/an_wishlist/classes/an_wish.php:76
939
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 205
0.340 ms 2 /classes/Product.php:3423
1047
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1018
0.340 ms 4 /classes/Product.php:3423
681
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 199
0.339 ms 1 /classes/Product.php:2902
795
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 904
0.339 ms 2 /classes/Product.php:3423
908
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 201) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.339 ms 1 /classes/stock/StockAvailable.php:753
673
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 194
0.338 ms 1 /classes/Product.php:2902
713
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 76 AND `id_shop` = 1 LIMIT 1
0.338 ms 1 /classes/module/Module.php:2109
659
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1068 AND `id_group` = 1 LIMIT 1
0.338 ms 0 /classes/GroupReduction.php:156
1005
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.338 ms 1 /classes/stock/StockAvailable.php:806
658
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1068 AND id_shop=1 LIMIT 1
0.337 ms 1 /classes/Product.php:6848
669
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 97
0.337 ms 1 /classes/Product.php:2902
823
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 98) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.337 ms 1 /classes/stock/StockAvailable.php:778
925
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 202
0.337 ms 1 /classes/Product.php:2902
717
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_simplefreeshippingline" LIMIT 1
0.337 ms 1 /classes/module/Module.php:2636
858
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 197 LIMIT 1
0.337 ms 82 /modules/an_wishlist/classes/an_wish_products.php:124
917
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.337 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1026
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7624 LIMIT 1
0.337 ms 7 /modules/an_wishlist/classes/an_wish_products.php:124
1040
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 890) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.337 ms 1 /classes/stock/StockAvailable.php:753
478
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 198
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.336 ms 1 /classes/SpecificPrice.php:259
707
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 890
0.336 ms 1 /classes/Product.php:2902
547
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 205 AND id_shop=1 LIMIT 1
0.336 ms 1 /classes/Product.php:6848
641
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.336 ms 1 /classes/Product.php:5639
736
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_wishlist" LIMIT 1
0.336 ms 1 /classes/module/Module.php:2636
739
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_shoppingcart" LIMIT 1
0.336 ms 1 /classes/module/Module.php:2636
921
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 202) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:806
969
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 729) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:806
993
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 731) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:806
459
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 195 AND id_shop=1 LIMIT 1
0.335 ms 1 /classes/Product.php:6848
481
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 198 AND id_shop=1 LIMIT 1
0.335 ms 1 /classes/Product.php:6848
498
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.335 ms 1 /classes/Product.php:5639
981
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 730) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.335 ms 1 /classes/stock/StockAvailable.php:806
461
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:453
525
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 202 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6848
531
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.334 ms 1 /classes/Product.php:5639
849
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:806
937
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 204
0.334 ms 1 /classes/Product.php:2902
965
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.334 ms 1 /modules/an_wishlist/classes/an_wish.php:76
975
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 730
0.334 ms 1 /classes/Product.php:3423
1017
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:806
1063
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:778
414
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 904 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6848
903
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 201
0.334 ms 2 /classes/Product.php:3423
516
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 201) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
671
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 98
0.333 ms 1 /classes/Product.php:2902
483
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 198) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
789
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5967) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:806
829
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 98
0.333 ms 1 /classes/Product.php:2902
977
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.333 ms 1 /modules/an_wishlist/classes/an_wish.php:76
991
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 731) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:778
647
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1018 AND id_shop=1 LIMIT 1
0.332 ms 1 /classes/Product.php:6848
722
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.332 ms 1 /classes/module/Module.php:2109
1053
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.332 ms 1 /classes/stock/StockAvailable.php:806
872
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 198) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:753
1051
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:778
492
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 199 AND id_shop=1 LIMIT 1
0.331 ms 1 /classes/Product.php:6848
871
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 198) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:778
1059
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1068
0.331 ms 2 /classes/Product.php:3423
632
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 890
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.330 ms 1 /classes/SpecificPrice.php:259
715
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 117 LIMIT 1
0.330 ms 1 /classes/Hook.php:244
564
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.330 ms 1 /classes/Product.php:5639
635
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 890 AND id_shop=1 LIMIT 1
0.330 ms 1 /classes/Product.php:6848
720
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.330 ms 1 /classes/module/Module.php:2109
909
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 201) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:806
932
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 204) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:753
1039
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 890) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.330 ms 1 /classes/stock/StockAvailable.php:778
559
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 728 AND `id_group` = 1 LIMIT 1
0.329 ms 0 /classes/GroupReduction.php:156
597
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.329 ms 1 /classes/Product.php:5639
807
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 97
0.329 ms 2 /classes/Product.php:3423
848
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:753
865
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 197
0.329 ms 1 /classes/Product.php:2902
963
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 729
0.329 ms 2 /classes/Product.php:3423
967
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 729) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:778
1016
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:753
1033
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7624
0.329 ms 1 /classes/Product.php:2902
1045
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 890
0.329 ms 1 /classes/Product.php:2902
410
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 24
AND `active` = 1 LIMIT 1
0.328 ms 1 /classes/Manufacturer.php:316
438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 98) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.328 ms 1 /classes/stock/StockAvailable.php:453
831
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 194
0.328 ms 2 /classes/Product.php:3423
603
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 766 AND `id_group` = 1 LIMIT 1
0.328 ms 0 /classes/GroupReduction.php:156
756
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.328 ms 1 /classes/Smarty/SmartyCustom.php:265
920
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 202) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:753
1041
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 890) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:806
626
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7624) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:453
867
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 198
0.327 ms 2 /classes/Product.php:3423
945
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 205) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:806
411
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 904
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.326 ms 1 /classes/SpecificPrice.php:259
812
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 97) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.326 ms 1 /classes/stock/StockAvailable.php:753
1117
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.326 ms 1 /classes/Smarty/SmartyCustom.php:265
427
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 97) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.326 ms 1 /classes/stock/StockAvailable.php:453
745
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572904))
0.326 ms 1 /classes/Smarty/SmartyCustom.php:265
1029
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7624) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.326 ms 1 /classes/stock/StockAvailable.php:806
724
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_client_service" LIMIT 1
0.325 ms 1 /classes/module/Module.php:2636
891
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 200
0.325 ms 2 /classes/Product.php:3423
505
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:453
542
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.325 ms 1 /classes/Product.php:5639
697
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 730
0.325 ms 1 /classes/Product.php:2902
861
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 197) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:806
619
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.324 ms 1 /classes/Product.php:5639
821
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11152432
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.324 ms 1 /modules/an_wishlist/classes/an_wish.php:76
927
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 204
0.324 ms 2 /classes/Product.php:3423
1014
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4176 LIMIT 1
0.324 ms 4 /modules/an_wishlist/classes/an_wish_products.php:124
425
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 97 AND id_shop=1 LIMIT 1
0.323 ms 1 /classes/Product.php:6848
433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 98
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.323 ms 1 /classes/SpecificPrice.php:259
445
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 194
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.323 ms 1 /classes/SpecificPrice.php:259
493
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 199 AND `id_group` = 1 LIMIT 1
0.323 ms 0 /classes/GroupReduction.php:156
999
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 766
0.323 ms 2 /classes/Product.php:3423
718
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 157 AND `id_shop` = 1 LIMIT 1
0.323 ms 1 /classes/module/Module.php:2109
811
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 97) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.323 ms 1 /classes/stock/StockAvailable.php:778
460
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 195 AND `id_group` = 1 LIMIT 1
0.322 ms 0 /classes/GroupReduction.php:156
737
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.322 ms 1 /classes/module/Module.php:2109
777
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.322 ms 1 /classes/module/Module.php:2636
781
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.322 ms 1 /classes/module/Module.php:2109
1057
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1018
0.321 ms 1 /classes/Product.php:2902
575
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.321 ms 1 /classes/Product.php:5639
503
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 200 AND id_shop=1 LIMIT 1
0.320 ms 1 /classes/Product.php:6848
847
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 195) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:778
1023
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7624
0.320 ms 3 /classes/Product.php:3423
664
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5967
0.320 ms 1 /classes/Product.php:2902
933
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 204) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:806
1076
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.320 ms 1 /classes/module/Module.php:2109
522
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 202
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 1 /classes/SpecificPrice.php:259
735
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 15 AND `id_shop` = 1 LIMIT 1
0.319 ms 1 /classes/module/Module.php:2109
780
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_productattributes" LIMIT 1
0.319 ms 1 /classes/module/Module.php:2636
514
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 201 AND id_shop=1 LIMIT 1
0.318 ms 1 /classes/Product.php:6848
895
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:778
992
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 731) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:753
1004
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 766) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:753
1069
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1068
0.318 ms 1 /classes/Product.php:2902
800
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 904) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:753
644
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1018
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.317 ms 1 /classes/SpecificPrice.php:259
944
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 205) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.317 ms 1 /classes/stock/StockAvailable.php:753
1011
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4176
0.317 ms 3 /classes/Product.php:3423
1021
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4176
0.317 ms 1 /classes/Product.php:2902
775
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
0.316 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
824
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 98) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.316 ms 1 /classes/stock/StockAvailable.php:753
884
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 199) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.316 ms 1 /classes/stock/StockAvailable.php:753
420
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.316 ms 1 /classes/Product.php:5639
679
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 198
0.316 ms 1 /classes/Product.php:2902
442
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.315 ms 1 /classes/Product.php:5639
957
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.315 ms 1 /classes/stock/StockAvailable.php:806
613
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4176 AND id_shop=1 LIMIT 1
0.315 ms 1 /classes/Product.php:6848
716
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 48 LIMIT 1
0.315 ms 1 /classes/Hook.php:244
773
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "sociallogin" LIMIT 1
0.315 ms 1 /classes/module/Module.php:2636
527
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 202) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
727
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 125 AND `id_shop` = 1 LIMIT 1
0.314 ms 1 /classes/module/Module.php:2109
882
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 199 LIMIT 1
0.314 ms 84 /modules/an_wishlist/classes/an_wish_products.php:124
465
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.313 ms 1 /classes/Product.php:5639
643
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 7
AND `active` = 1 LIMIT 1
0.313 ms 1 /classes/Manufacturer.php:316
788
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5967) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:753
1028
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7624) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:753
402
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5967 AND id_shop=1 LIMIT 1
0.312 ms 1 /classes/Product.php:6848
624
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7624 AND id_shop=1 LIMIT 1
0.312 ms 1 /classes/Product.php:6848
776
SELECT SQL_NO_CACHE `iso_code`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.312 ms 1 /classes/Country.php:275
774
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1
0.311 ms 1 /classes/module/Module.php:2109
726
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "darkmode" LIMIT 1
0.311 ms 1 /classes/module/Module.php:2636
537
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 204 AND `id_group` = 1 LIMIT 1
0.310 ms 0 /classes/GroupReduction.php:156
837
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:806
636
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 890 AND `id_group` = 1 LIMIT 1
0.310 ms 0 /classes/GroupReduction.php:156
416
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 904) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.309 ms 1 /classes/stock/StockAvailable.php:453
665
SELECT SQL_NO_CACHE state FROM mangayo_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.309 ms 1 /classes/FeatureFlag.php:105
825
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 98) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.309 ms 1 /classes/stock/StockAvailable.php:806
437
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 98 AND `id_group` = 1 LIMIT 1
0.308 ms 0 /classes/GroupReduction.php:156
1064
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1068) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.307 ms 1 /classes/stock/StockAvailable.php:753
471
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 197 AND `id_group` = 1 LIMIT 1
0.305 ms 0 /classes/GroupReduction.php:156
980
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 730) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.305 ms 1 /classes/stock/StockAvailable.php:753
588
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 731
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.303 ms 1 /classes/SpecificPrice.php:259
526
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 202 AND `id_group` = 1 LIMIT 1
0.302 ms 0 /classes/GroupReduction.php:156
456
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 195
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.301 ms 1 /classes/SpecificPrice.php:259
648
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1018 AND `id_group` = 1 LIMIT 1
0.301 ms 0 /classes/GroupReduction.php:156
771
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572905))
0.299 ms 1 /classes/Smarty/SmartyCustom.php:265
403
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5967 AND `id_group` = 1 LIMIT 1
0.293 ms 0 /classes/GroupReduction.php:156
625
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7624 AND `id_group` = 1 LIMIT 1
0.292 ms 0 /classes/GroupReduction.php:156
482
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 198 AND `id_group` = 1 LIMIT 1
0.286 ms 0 /classes/GroupReduction.php:156

Doubles

48 queries
SELECT image_shop.`id_image`
                    FROM `mangayo_image` i
                     INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries
SELECT name FROM mangayo_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries
SELECT *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `mangayo_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
48 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `mangayo_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
48 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries
                            SELECT `id_tax_rules_group`
                            FROM `mangayo_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries
			SELECT `reduction`
			FROM `mangayo_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries
SELECT SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `mangayo_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM mangayo_feature_product pf
                LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN mangayo_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
48 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `mangayo_image` i
             INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
48 queries
SELECT `id_product_attribute`
            FROM `mangayo_product_attribute`
            WHERE `id_product` = XX
34 queries
SELECT `id_module` FROM `mangayo_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
25 queries
            SELECT `id_wishlist`
            FROM `mangayo_an_wishlist`
            WHERE `id_customer` = XX
            AND `is_guest` = XX
            AND `id_shop` = XX LIMIT XX
24 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `mangayo_product_attribute` pa
             INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
24 queries
                SELECT `id_category` FROM `mangayo_category_product`
                WHERE `id_product` = XX
24 queries
            SELECT COUNT(*)
            FROM `mangayo_an_wishlist_products`
            WHERE `id_product` = XX LIMIT XX
24 queries
SELECT out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT product_attribute_shop.id_product_attribute
                FROM mangayo_product_attribute pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
SELECT ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
                    a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
                    IFNULL(stock.quantity, XX) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
                    product_attribute_shop.`default_on`, pa.`reference`, pa.`eanXX`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
                    product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
                    pal.`available_now`, pal.`available_later`
                FROM `mangayo_product_attribute` pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
                LEFT JOIN `mangayo_product_attribute_lang` pal
                    ON (
                        pa.`id_product_attribute` = pal.`id_product_attribute` AND
                        pal.`id_lang` = XX)
                LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
                LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
                LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
                 INNER JOIN mangayo_attribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX)
                WHERE pa.`id_product` = XX
                    AND al.`id_lang` = XX
                    AND agl.`id_lang` = XX
                GROUP BY id_attribute_group, id_product_attribute
                ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
17 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
14 queries
SELECT *
            FROM `mangayo_andropdown` d
            LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
            WHERE d.`id_anmenu` = XX
            AND `id_lang` = XX
            AND `active` = XX
            GROUP BY d.`id_andropdown`
            ORDER BY d.`position` ASC
10 queries
SELECT *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = XX
WHERE (a.`id_cms` = XX) LIMIT XX
10 queries
SELECT *
							FROM `mangayo_cms_lang`
							WHERE `id_cms` = XX AND `id_shop` = XX
6 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"an_megamenu|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
4 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries
SELECT *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
3 queries
							SELECT `name`
							FROM `mangayo_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
				SELECT `name`
				FROM `mangayo_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
3 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
3 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
3 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_linklist|displayFooter|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
3 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_customeraccountlinks|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `mangayo_module` m
                LEFT JOIN `mangayo_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `mangayo_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
SELECT XX FROM `mangayo_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
			SELECT `need_identification_number`
			FROM `mangayo_country`
			WHERE `id_country` = XX LIMIT XX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
			SELECT cl.`link_rewrite`
			FROM `mangayo_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
2 queries
				SELECT tr.*
				FROM `mangayo_tax_rule` tr
				JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = XX) LIMIT XX
2 queries
SELECT `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=XX) AND (`active`= XX)
2 queries
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
2 queries
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="" AND compile_id="charme" LIMIT XX
2 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"","charme", FROM_UNIXTIME(XX))
2 queries
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="an_megamenu|XX|XX|XX|XX" AND compile_id="charme" LIMIT XX
2 queries
SELECT *
            FROM `mangayo_anmenu` m
            LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
            
            WHERE m.`id_shop` = XX
            AND `id_lang` = XX
            AND `active` = XX
            
            GROUP BY m.`id_anmenu`
            ORDER BY m.`position` ASC
2 queries
SELECT m.*, ml.`description`, ml.`short_description`
            FROM `mangayo_manufacturer` m
             INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)
            LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)
            WHERE m.`id_manufacturer` IN (XX)
            AND m.`active` = XX
            GROUP BY m.`id_manufacturer`
            ORDER BY m.`name`
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) as quantity, pl.`description`,
            pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
            pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
            m.`name` AS manufacturer_name,
            DATEDIFF(
                product_shop.`date_add`,
                DATE_SUB(
                    NOW(),
                    INTERVAL XX DAY
                )
            ) > XX AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
 INNER JOIN mangayo_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = XX AND pl.id_shop = XX 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
 LEFT JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX AND image_shop.cover=XX)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = XX
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
 LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX AND product_attribute_shop.default_on = XX)
 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
WHERE (p.`id_product` IN (XX))
GROUP BY product_shop.id_product
2 queries
SELECT *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = XX
WHERE (a.`id_link_block` = XX) LIMIT XX
2 queries
SELECT *
							FROM `mangayo_link_block_lang`
							WHERE `id_link_block` = XX

Tables stress

158 product
157 product_shop
155 stock_available
129 product_attribute
123 product_attribute_shop
99 image_shop
98 image
97 cart_product
71 feature_product
62 category_lang
55 product_attribute_combination
53 product_lang
52 specific_price
52 feature_value_lang
51 image_lang
49 feature_lang
49 feature
49 feature_shop
48 specific_price_priority
48 product_group_reduction_cache
48 pack
48 attribute
48 attribute_lang
48 attribute_group
44 module
37 module_shop
35 category_product
25 an_wishlist
24 an_productextratabs_labels_relations
24 an_productextratabs_labels_lang
24 an_wishlist_products
24 product_attribute_lang
24 attribute_group_lang
24 attribute_shop
21 category
14 andropdown
14 andropdown_lang
11 category_group
10 hook
10 category_shop
10 manufacturer
10 cms
10 cms_shop
10 cms_lang
6 product_sale
6 smarty_lazy_cache
5 lang
5 country
5 currency
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 manufacturer_shop
4 manufacturer_lang
4 feature_value
4 layered_indexable_feature_value_lang_value
3 hook_alias
3 image_type
3 link_block
3 link_block_shop
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 cart_rule_lang
2 smarty_last_flush
2 tax_rule
2 tax_rules_group
2 social_login_position
2 anmenu
2 anmenu_lang
2 link_block_lang
2 date_range
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 group_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 orders
1 hicookietype
1 hicookietype_lang
1 hicookietype_shop
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 dark_mode
1 an_trust_badges_widgets
1 an_trust_badges_widgets_lang
1 an_trust_badges_icons
1 connections
1 page_type
1 page
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 145 /classes/Link.php:113 (__construct) [id: 284]
/classes/Link.php:113 (__construct) [id: 285]
/classes/Link.php:113 (__construct) [id: 286]
/classes/Link.php:113 (__construct) [id: 287]
/classes/Link.php:113 (__construct) [id: 288]
/classes/Link.php:113 (__construct) [id: 289]
/classes/Link.php:113 (__construct) [id: 290]
/classes/Link.php:113 (__construct) [id: 291]
/classes/Link.php:113 (__construct) [id: 292]
/classes/Link.php:113 (__construct) [id: 293]
/classes/Link.php:113 (__construct) [id: 294]
/classes/Link.php:113 (__construct) [id: 295]
/classes/Link.php:113 (__construct) [id: 296]
/classes/Link.php:113 (__construct) [id: 297]
/classes/Link.php:113 (__construct) [id: 298]
/classes/Link.php:113 (__construct) [id: 299]
/classes/Link.php:113 (__construct) [id: 300]
/classes/Link.php:113 (__construct) [id: 301]
/classes/Link.php:113 (__construct) [id: 302]
/classes/Link.php:113 (__construct) [id: 303]
/classes/Link.php:113 (__construct) [id: 304]
/classes/Link.php:113 (__construct) [id: 305]
/classes/Link.php:113 (__construct) [id: 306]
/classes/Link.php:113 (__construct) [id: 307]
/modules/codwfeeplus/codwfeeplus.php:410 (__construct) [id: 12211]
/classes/Link.php:113 (__construct) [id: 5967]
/classes/Link.php:113 (__construct) [id: 904]
/classes/Link.php:113 (__construct) [id: 97]
/classes/Link.php:113 (__construct) [id: 98]
/classes/Link.php:113 (__construct) [id: 194]
/classes/Link.php:113 (__construct) [id: 195]
/classes/Link.php:113 (__construct) [id: 197]
/classes/Link.php:113 (__construct) [id: 198]
/classes/Link.php:113 (__construct) [id: 199]
/classes/Link.php:113 (__construct) [id: 200]
/classes/Link.php:113 (__construct) [id: 201]
/classes/Link.php:113 (__construct) [id: 202]
/classes/Link.php:113 (__construct) [id: 204]
/classes/Link.php:113 (__construct) [id: 205]
/classes/Link.php:113 (__construct) [id: 728]
/classes/Link.php:113 (__construct) [id: 729]
/classes/Link.php:113 (__construct) [id: 730]
/classes/Link.php:113 (__construct) [id: 731]
/classes/Link.php:113 (__construct) [id: 766]
/classes/Link.php:113 (__construct) [id: 4176]
/classes/Link.php:113 (__construct) [id: 7624]
/classes/Link.php:113 (__construct) [id: 890]
/classes/Link.php:113 (__construct) [id: 1018]
/classes/Link.php:113 (__construct) [id: 1068]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5967]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 904]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 97]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 98]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 194]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 195]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 197]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 198]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 199]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 200]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 201]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 202]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 204]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 205]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 728]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 729]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 730]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 731]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 766]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4176]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7624]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 890]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1018]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1068]
/classes/Link.php:113 (__construct) [id: 5967]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5967]
/classes/Link.php:113 (__construct) [id: 5967]
/classes/Link.php:113 (__construct) [id: 904]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 904]
/classes/Link.php:113 (__construct) [id: 904]
/classes/Link.php:113 (__construct) [id: 97]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 97]
/classes/Link.php:113 (__construct) [id: 97]
/classes/Link.php:113 (__construct) [id: 98]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 98]
/classes/Link.php:113 (__construct) [id: 98]
/classes/Link.php:113 (__construct) [id: 194]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 194]
/classes/Link.php:113 (__construct) [id: 194]
/classes/Link.php:113 (__construct) [id: 195]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 195]
/classes/Link.php:113 (__construct) [id: 195]
/classes/Link.php:113 (__construct) [id: 197]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 197]
/classes/Link.php:113 (__construct) [id: 197]
/classes/Link.php:113 (__construct) [id: 198]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 198]
/classes/Link.php:113 (__construct) [id: 198]
/classes/Link.php:113 (__construct) [id: 199]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 199]
/classes/Link.php:113 (__construct) [id: 199]
/classes/Link.php:113 (__construct) [id: 200]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 200]
/classes/Link.php:113 (__construct) [id: 200]
/classes/Link.php:113 (__construct) [id: 201]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 201]
/classes/Link.php:113 (__construct) [id: 201]
/classes/Link.php:113 (__construct) [id: 202]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 202]
/classes/Link.php:113 (__construct) [id: 202]
/classes/Link.php:113 (__construct) [id: 204]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 204]
/classes/Link.php:113 (__construct) [id: 204]
/classes/Link.php:113 (__construct) [id: 205]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 205]
/classes/Link.php:113 (__construct) [id: 205]
/classes/Link.php:113 (__construct) [id: 728]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 728]
/classes/Link.php:113 (__construct) [id: 728]
/classes/Link.php:113 (__construct) [id: 729]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 729]
/classes/Link.php:113 (__construct) [id: 729]
/classes/Link.php:113 (__construct) [id: 730]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 730]
/classes/Link.php:113 (__construct) [id: 730]
/classes/Link.php:113 (__construct) [id: 731]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 731]
/classes/Link.php:113 (__construct) [id: 731]
/classes/Link.php:113 (__construct) [id: 766]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 766]
/classes/Link.php:113 (__construct) [id: 766]
/classes/Link.php:113 (__construct) [id: 4176]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4176]
/classes/Link.php:113 (__construct) [id: 4176]
/classes/Link.php:113 (__construct) [id: 7624]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7624]
/classes/Link.php:113 (__construct) [id: 7624]
/classes/Link.php:113 (__construct) [id: 890]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 890]
/classes/Link.php:113 (__construct) [id: 890]
/classes/Link.php:113 (__construct) [id: 1018]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1018]
/classes/Link.php:113 (__construct) [id: 1018]
/classes/Link.php:113 (__construct) [id: 1068]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1068]
/classes/Link.php:113 (__construct) [id: 1068]
Category 11 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 88]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 90]
/classes/Meta.php:380 (__construct) [id: 11]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/facebookproductad/lib/pixel/pixelCategory.php:46 (__construct) [id: 11]
/modules/facebookproductad/lib/moduleTools.php:481 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 11]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 11]
CMS 11 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 0]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 16]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 3]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 1]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 19]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 8]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 9]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 10]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 11]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 15]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 23]
Country 7 /config/config.inc.php:146 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1725 (__construct) [id: 10]
/modules/paypal/paypal.php:324 (__construct) [id: 10]
/modules/paypal/classes/AbstractMethodPaypal.php:90 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/modules/ps_contactinfo/ps_contactinfo.php:104 (__construct) [id: 10]
State 5 /classes/AddressFormat.php:404 (__construct) [id: 211]
/classes/controller/FrontController.php:1724 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:93 (__construct) [id: 211]
/classes/AddressFormat.php:404 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:103 (__construct) [id: 211]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3691 (initialize) [id: ]
/classes/Product.php:3801 (__construct) [id: ]
/classes/Product.php:5936 (__construct) [id: ]
Language 4 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:559 (__construct) [id: 1]
/modules/facebookproductad/lib/hook/hookDisplay.php:90 (__construct) [id: 1]
/modules/facebookproductad/lib/pixel/pixelCategory.php:39 (__construct) [id: 1]
Cart 4 /classes/controller/FrontController.php:429 (__construct) [id: ]
/classes/controller/FrontController.php:499 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Configuration 2 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 2 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
AddressFormat 2 /classes/controller/FrontController.php:1719 (generateAddress) [id: ]
/modules/ps_contactinfo/ps_contactinfo.php:98 (generateAddress) [id: ]
Hook 2 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
PrestaShop\Module\LinkList\Model\LinkBlock 2 /modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 1]
/modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 6]
BoldizArt\DarkMode\Model\DarkModeOptionsModel 2 /modules/darkmode/darkmode.php:227 (__construct) [id: 1]
/modules/darkmode/darkmode.php:227 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:687 (getCurrencyInstance) [id: 1]
OrderState 2 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
ImageType 1 /modules/an_brandslider/an_brandslider.php:440 (__construct) [id: 14]
Risk 1 /classes/controller/FrontController.php:1652 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1649 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/api-platform/core/src/deprecation.php
40 /vendor/api-platform/core/src/Api/FilterInterface.php
41 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
42 /vendor/api-platform/core/src/deprecated_interfaces.php
43 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
58 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
61 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
62 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
65 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
66 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
67 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
68 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
69 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
70 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
71 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
72 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
73 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
74 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
75 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
76 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
77 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
78 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
88 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
89 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
97 /vendor/psr/container/src/ContainerInterface.php
98 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
99 /vendor/ircmaxell/password-compat/lib/password.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /src/Core/Session/SessionHandler.php
171 /src/Core/Session/SessionHandlerInterface.php
172 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
173 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
174 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
175 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
176 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
177 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
188 /config/smarty.config.inc.php
189 /classes/Smarty/SmartyCustom.php
190 /vendor/smarty/smarty/libs/Smarty.class.php
191 /vendor/smarty/smarty/libs/functions.php
192 /vendor/smarty/smarty/libs/Autoloader.php
193 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
194 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
195 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
196 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
197 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
202 /config/smartyfront.config.inc.php
203 /classes/Smarty/SmartyResourceModule.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
206 /classes/Smarty/SmartyResourceParent.php
207 /classes/Smarty/SmartyLazyRegister.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
209 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
210 /classes/Customer.php
211 /classes/Group.php
212 /classes/Link.php
213 /classes/shop/ShopUrl.php
214 /classes/Dispatcher.php
215 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
216 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
217 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
218 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
219 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
222 /src/Adapter/SymfonyContainer.php
223 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
224 /config/db_slave_server.inc.php
225 /modules/anblog/anblog.php
226 /modules/anblog/loader.php
227 /modules/anblog/classes/config.php
228 /modules/anblog/config.php
229 /modules/anblog/libs/Helper.php
230 /modules/anblog/libs/AnblogImage.php
231 /modules/anblog/classes/anBlogLikes.php
232 /modules/anblog/classes/anblogcat.php
233 /modules/anblog/classes/blog.php
234 /modules/anblog/classes/link.php
235 /modules/anblog/classes/comment.php
236 /modules/anblog/classes/sitemap.php
237 /modules/anblog/classes/anBlogWidgets.php
238 /src/Core/Security/Hashing.php
239 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
241 /classes/Translate.php
242 /modules/anblog/translations/it.php
243 /src/PrestaShopBundle/Translation/TranslatorComponent.php
244 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
246 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
247 /vendor/symfony/contracts/Translation/TranslatorInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
249 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
250 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
258 /vendor/symfony/contracts/Translation/TranslatorTrait.php
259 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
261 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
262 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
263 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
264 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
266 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
267 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
268 /override/controllers/front/listing/CategoryController.php
269 /controllers/front/listing/CategoryController.php
270 /classes/controller/ProductListingFrontController.php
271 /classes/controller/ProductPresentingFrontController.php
272 /classes/controller/FrontController.php
273 /src/Adapter/Presenter/Object/ObjectPresenter.php
274 /src/Adapter/Presenter/PresenterInterface.php
275 /src/Adapter/Presenter/Cart/CartPresenter.php
276 /src/Adapter/Product/PriceFormatter.php
277 /src/Adapter/Image/ImageRetriever.php
278 /classes/tax/TaxConfiguration.php
279 /classes/Smarty/TemplateFinder.php
280 /classes/assets/StylesheetManager.php
281 /classes/assets/AbstractAssetManager.php
282 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
283 /classes/assets/JavascriptManager.php
284 /classes/assets/CccReducer.php
285 /classes/Category.php
286 /classes/webservice/WebserviceRequest.php
287 /src/Adapter/ContainerBuilder.php
288 /src/Adapter/Environment.php
289 /src/Core/EnvironmentInterface.php
290 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
291 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
292 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
293 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
294 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
295 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
296 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
297 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
298 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
299 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
300 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
301 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
302 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
303 /vendor/symfony/contracts/Service/ResetInterface.php
304 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
305 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
306 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
308 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
309 /vendor/symfony/contracts/Cache/ItemInterface.php
310 /vendor/psr/cache/src/CacheItemInterface.php
311 /vendor/psr/cache/src/CacheItemPoolInterface.php
312 /vendor/symfony/contracts/Cache/CacheInterface.php
313 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
315 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
317 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
318 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
319 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
321 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
325 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
326 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
327 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
330 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
332 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
333 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
334 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
335 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
374 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
375 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
376 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
377 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
378 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
381 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
382 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
383 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
384 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
385 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
386 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
387 /var/cache/dev/FrontContainer.php
388 /src/Adapter/Container/LegacyContainer.php
389 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
390 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
391 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
392 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
393 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
394 /vendor/psr/container/src/ContainerExceptionInterface.php
395 /vendor/psr/container/src/NotFoundExceptionInterface.php
396 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
397 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
399 /src/Adapter/Container/LegacyContainerInterface.php
400 /modules/contactform/vendor/autoload.php
401 /modules/contactform/vendor/composer/autoload_real.php
402 /modules/contactform/vendor/composer/autoload_static.php
403 /modules/dashactivity/vendor/autoload.php
404 /modules/dashactivity/vendor/composer/autoload_real.php
405 /modules/dashactivity/vendor/composer/autoload_static.php
406 /modules/dashtrends/vendor/autoload.php
407 /modules/dashtrends/vendor/composer/autoload_real.php
408 /modules/dashtrends/vendor/composer/autoload_static.php
409 /modules/dashproducts/vendor/autoload.php
410 /modules/dashproducts/vendor/composer/autoload_real.php
411 /modules/dashproducts/vendor/composer/autoload_static.php
412 /modules/graphnvd3/vendor/autoload.php
413 /modules/graphnvd3/vendor/composer/autoload_real.php
414 /modules/graphnvd3/vendor/composer/autoload_static.php
415 /modules/gridhtml/vendor/autoload.php
416 /modules/gridhtml/vendor/composer/autoload_real.php
417 /modules/gridhtml/vendor/composer/autoload_static.php
418 /modules/ps_banner/vendor/autoload.php
419 /modules/ps_banner/vendor/composer/autoload_real.php
420 /modules/ps_banner/vendor/composer/platform_check.php
421 /modules/ps_banner/vendor/composer/autoload_static.php
422 /modules/ps_categorytree/vendor/autoload.php
423 /modules/ps_categorytree/vendor/composer/autoload_real.php
424 /modules/ps_categorytree/vendor/composer/platform_check.php
425 /modules/ps_categorytree/vendor/composer/autoload_static.php
426 /modules/ps_contactinfo/vendor/autoload.php
427 /modules/ps_contactinfo/vendor/composer/autoload_real.php
428 /modules/ps_contactinfo/vendor/composer/platform_check.php
429 /modules/ps_contactinfo/vendor/composer/autoload_static.php
430 /modules/ps_currencyselector/vendor/autoload.php
431 /modules/ps_currencyselector/vendor/composer/autoload_real.php
432 /modules/ps_currencyselector/vendor/composer/platform_check.php
433 /modules/ps_currencyselector/vendor/composer/autoload_static.php
434 /modules/ps_customeraccountlinks/vendor/autoload.php
435 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
436 /modules/ps_customeraccountlinks/vendor/composer/platform_check.php
437 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
438 /modules/ps_customersignin/vendor/autoload.php
439 /modules/ps_customersignin/vendor/composer/autoload_real.php
440 /modules/ps_customersignin/vendor/composer/platform_check.php
441 /modules/ps_customersignin/vendor/composer/autoload_static.php
442 /modules/ps_customtext/vendor/autoload.php
443 /modules/ps_customtext/vendor/composer/autoload_real.php
444 /modules/ps_customtext/vendor/composer/platform_check.php
445 /modules/ps_customtext/vendor/composer/autoload_static.php
446 /modules/ps_emailsubscription/vendor/autoload.php
447 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
448 /modules/ps_emailsubscription/vendor/composer/platform_check.php
449 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
450 /modules/ps_faviconnotificationbo/vendor/autoload.php
451 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
452 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
453 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
454 /modules/ps_featuredproducts/vendor/autoload.php
455 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
456 /modules/ps_featuredproducts/vendor/composer/platform_check.php
457 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
458 /modules/ps_languageselector/vendor/autoload.php
459 /modules/ps_languageselector/vendor/composer/autoload_real.php
460 /modules/ps_languageselector/vendor/composer/platform_check.php
461 /modules/ps_languageselector/vendor/composer/autoload_static.php
462 /modules/ps_linklist/vendor/autoload.php
463 /modules/ps_linklist/vendor/composer/autoload_real.php
464 /modules/ps_linklist/vendor/composer/platform_check.php
465 /modules/ps_linklist/vendor/composer/autoload_static.php
466 /modules/ps_mainmenu/vendor/autoload.php
467 /modules/ps_mainmenu/vendor/composer/autoload_real.php
468 /modules/ps_mainmenu/vendor/composer/platform_check.php
469 /modules/ps_mainmenu/vendor/composer/autoload_static.php
470 /modules/ps_searchbar/vendor/autoload.php
471 /modules/ps_searchbar/vendor/composer/autoload_real.php
472 /modules/ps_searchbar/vendor/composer/platform_check.php
473 /modules/ps_searchbar/vendor/composer/autoload_static.php
474 /modules/ps_sharebuttons/vendor/autoload.php
475 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
476 /modules/ps_sharebuttons/vendor/composer/platform_check.php
477 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
478 /modules/ps_shoppingcart/vendor/autoload.php
479 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
480 /modules/ps_shoppingcart/vendor/composer/platform_check.php
481 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
482 /modules/ps_socialfollow/vendor/autoload.php
483 /modules/ps_socialfollow/vendor/composer/autoload_real.php
484 /modules/ps_socialfollow/vendor/composer/platform_check.php
485 /modules/ps_socialfollow/vendor/composer/autoload_static.php
486 /modules/ps_themecusto/vendor/autoload.php
487 /modules/ps_themecusto/vendor/composer/autoload_real.php
488 /modules/ps_themecusto/vendor/composer/platform_check.php
489 /modules/ps_themecusto/vendor/composer/autoload_static.php
490 /modules/pagesnotfound/vendor/autoload.php
491 /modules/pagesnotfound/vendor/composer/autoload_real.php
492 /modules/pagesnotfound/vendor/composer/autoload_static.php
493 /modules/psgdpr/vendor/autoload.php
494 /modules/psgdpr/vendor/composer/autoload_real.php
495 /modules/psgdpr/vendor/composer/autoload_static.php
496 /modules/ps_facetedsearch/vendor/autoload.php
497 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
498 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
499 /modules/ps_categoryproducts/vendor/autoload.php
500 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
501 /modules/ps_categoryproducts/vendor/composer/platform_check.php
502 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
503 /modules/ps_viewedproduct/vendor/autoload.php
504 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
505 /modules/ps_viewedproduct/vendor/composer/platform_check.php
506 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
507 /modules/ps_crossselling/vendor/autoload.php
508 /modules/ps_crossselling/vendor/composer/autoload_real.php
509 /modules/ps_crossselling/vendor/composer/platform_check.php
510 /modules/ps_crossselling/vendor/composer/autoload_static.php
511 /modules/ps_bestsellers/vendor/autoload.php
512 /modules/ps_bestsellers/vendor/composer/autoload_real.php
513 /modules/ps_bestsellers/vendor/composer/platform_check.php
514 /modules/ps_bestsellers/vendor/composer/autoload_static.php
515 /modules/ps_dataprivacy/vendor/autoload.php
516 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
517 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
518 /modules/sociallogin/vendor/autoload.php
519 /modules/sociallogin/vendor/composer/autoload_real.php
520 /modules/sociallogin/vendor/composer/autoload_static.php
521 /modules/sociallogin/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
522 /modules/eicaptcha/vendor/autoload.php
523 /modules/eicaptcha/vendor/composer/autoload_real.php
524 /modules/eicaptcha/vendor/composer/platform_check.php
525 /modules/eicaptcha/vendor/composer/autoload_static.php
526 /modules/eicaptcha/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
527 /modules/eicaptcha/vendor/symfony/string/Resources/functions.php
528 /modules/paypal/vendor/autoload.php
529 /modules/paypal/vendor/composer/autoload_real.php
530 /modules/paypal/vendor/composer/autoload_static.php
531 /modules/paypal/vendor/paragonie/random_compat/lib/random.php
532 /modules/paypal/vendor/symfony/polyfill-php70/bootstrap.php
533 /modules/paypal/vendor/guzzlehttp/psr7/src/functions_include.php
534 /modules/paypal/vendor/guzzlehttp/psr7/src/functions.php
535 /modules/ps_emailalerts/vendor/autoload.php
536 /modules/ps_emailalerts/vendor/composer/autoload_real.php
537 /modules/ps_emailalerts/vendor/composer/platform_check.php
538 /modules/ps_emailalerts/vendor/composer/autoload_static.php
539 /modules/darkmode/vendor/autoload.php
540 /modules/darkmode/vendor/composer/autoload_real.php
541 /modules/darkmode/vendor/composer/platform_check.php
542 /modules/darkmode/vendor/composer/autoload_static.php
543 /modules/payplug/vendor/autoload.php
544 /modules/payplug/vendor/composer/autoload_real.php
545 /modules/payplug/vendor/composer/autoload_static.php
546 /modules/app_endpoint/vendor/autoload.php
547 /modules/app_endpoint/vendor/composer/autoload_real.php
548 /modules/app_endpoint/vendor/composer/platform_check.php
549 /modules/app_endpoint/vendor/composer/autoload_static.php
550 /modules/autoupgrade/vendor/autoload.php
551 /modules/autoupgrade/vendor/composer/autoload_real.php
552 /modules/autoupgrade/vendor/composer/autoload_static.php
553 /modules/ps_specials/vendor/autoload.php
554 /modules/ps_specials/vendor/composer/autoload_real.php
555 /modules/ps_specials/vendor/composer/autoload_static.php
556 /modules/mangayo_assistant/vendor/autoload.php
557 /modules/mangayo_assistant/vendor/composer/autoload_real.php
558 /modules/mangayo_assistant/vendor/composer/autoload_static.php
559 /src/Core/Localization/Locale/Repository.php
560 /src/Core/Localization/Locale/RepositoryInterface.php
561 /src/Core/Localization/CLDR/LocaleRepository.php
562 /src/Core/Localization/CLDR/LocaleDataSource.php
563 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
564 /src/Core/Data/Layer/AbstractDataLayer.php
565 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
566 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
567 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
568 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
569 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
570 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
571 /vendor/symfony/contracts/Cache/CacheTrait.php
572 /vendor/psr/cache/src/InvalidArgumentException.php
573 /vendor/psr/cache/src/CacheException.php
574 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
575 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
576 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
577 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
578 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
579 /src/Core/Localization/CLDR/Reader.php
580 /src/Core/Localization/CLDR/ReaderInterface.php
581 /src/Core/Localization/Currency/Repository.php
582 /src/Core/Localization/Currency/RepositoryInterface.php
583 /src/Core/Localization/Currency/CurrencyDataSource.php
584 /src/Core/Localization/Currency/DataSourceInterface.php
585 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
586 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
587 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
588 /src/Adapter/Currency/CurrencyDataProvider.php
589 /src/Core/Currency/CurrencyDataProviderInterface.php
590 /src/Adapter/LegacyContext.php
591 /src/Adapter/Tools.php
592 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
593 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
594 /vendor/prestashop/decimal/src/Operation/Rounding.php
595 /src/Core/Localization/Locale.php
596 /src/Core/Localization/LocaleInterface.php
597 /src/Core/Localization/Specification/Price.php
598 /src/Core/Localization/Specification/Number.php
599 /src/Core/Localization/Specification/NumberInterface.php
600 /src/Core/Localization/Specification/Factory.php
601 /src/Core/Localization/CLDR/LocaleData.php
602 /src/Core/Localization/CLDR/NumberSymbolsData.php
603 /src/Core/Localization/CLDR/CurrencyData.php
604 /src/Core/Localization/CLDR/Locale.php
605 /src/Core/Localization/CLDR/LocaleInterface.php
606 /src/Core/Localization/Specification/NumberSymbolList.php
607 /classes/Currency.php
608 /src/Core/Localization/Currency/LocalizedCurrencyId.php
609 /src/Core/Localization/Currency/CurrencyData.php
610 /src/Core/Localization/Currency/CurrencyCollection.php
611 /src/Core/Localization/Currency.php
612 /src/Core/Localization/CurrencyInterface.php
613 /src/Core/Localization/Specification/NumberCollection.php
614 /src/Core/Localization/Number/Formatter.php
615 /classes/Cart.php
616 /src/Adapter/AddressFactory.php
617 /classes/CartRule.php
618 /classes/Product.php
619 /src/Core/Domain/Product/ValueObject/RedirectType.php
620 /src/Core/Util/DateTime/DateTime.php
621 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
622 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
623 /src/Core/Domain/Product/ValueObject/ProductType.php
624 /src/Core/Domain/Product/ValueObject/Reference.php
625 /src/Core/Domain/Product/ValueObject/Ean13.php
626 /src/Core/Domain/Product/ValueObject/Isbn.php
627 /src/Core/Domain/Product/ValueObject/Upc.php
628 /src/Core/Domain/Product/ProductSettings.php
629 /src/Core/Domain/Shop/ValueObject/ShopId.php
630 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
631 /modules/ps_emailsubscription/ps_emailsubscription.php
632 /src/Core/Module/WidgetInterface.php
633 /src/PrestaShopBundle/Translation/DomainNormalizer.php
634 /classes/Media.php
635 /modules/ps_socialfollow/ps_socialfollow.php
636 /modules/ps_emailalerts/ps_emailalerts.php
637 /modules/ps_emailalerts/MailAlert.php
638 /classes/ProductDownload.php
639 /classes/tax/Tax.php
640 /src/Core/Localization/CLDR/ComputingPrecision.php
641 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
642 /src/Core/Cart/Calculator.php
643 /src/Core/Cart/CartRowCollection.php
644 /src/Core/Cart/Fees.php
645 /src/Core/Cart/AmountImmutable.php
646 /src/Core/Cart/CartRuleCollection.php
647 /src/Core/Cart/CartRuleCalculator.php
648 /src/Adapter/Product/PriceCalculator.php
649 /classes/order/Order.php
650 /src/Core/Cart/CartRow.php
651 /vendor/prestashop/decimal/src/DecimalNumber.php
652 /vendor/prestashop/decimal/src/Builder.php
653 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
654 /classes/Gender.php
655 /classes/Risk.php
656 /classes/Meta.php
657 /classes/Address.php
658 /classes/ImageType.php
659 /classes/State.php
660 /src/Core/Security/PasswordPolicyConfiguration.php
661 /src/Core/Configuration/DataConfigurationInterface.php
662 /src/Core/Filter/FrontEndObject/MainFilter.php
663 /src/Core/Filter/FilterInterface.php
664 /src/Core/Filter/FrontEndObject/CartFilter.php
665 /src/Core/Filter/HashMapWhitelistFilter.php
666 /src/Core/Filter/CollectionFilter.php
667 /src/Core/Filter/FrontEndObject/ProductFilter.php
668 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
669 /src/Core/Filter/FrontEndObject/CustomerFilter.php
670 /src/Core/Filter/FrontEndObject/ShopFilter.php
671 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
672 /modules/ps_shoppingcart/ps_shoppingcart.php
673 /modules/ets_crosssell/ets_crosssell.php
674 /modules/ets_crosssell/Ets_crosssell_db.php
675 /modules/ets_crosssell/translations/it.php
676 /vendor/defuse/php-encryption/src/Crypto.php
677 /vendor/defuse/php-encryption/src/KeyOrPassword.php
678 /vendor/defuse/php-encryption/src/RuntimeTests.php
679 /vendor/defuse/php-encryption/src/DerivedKeys.php
680 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
681 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
682 /classes/Manufacturer.php
683 /src/Core/Util/String/StringModifier.php
684 /src/Core/Util/String/StringModifierInterface.php
685 /modules/ps_searchbar/ps_searchbar.php
686 /modules/an_productextratabs/an_productextratabs.php
687 /modules/an_productextratabs/classes/anTabsCombinations.php
688 /modules/an_productextratabs/classes/anProductTabs.php
689 /modules/an_productextratabs/classes/anProductTabsTplContent.php
690 /modules/an_productextratabs/classes/anProductTabsLabels.php
691 /modules/an_productextratabs/translations/it.php
692 /modules/an_client_service/an_client_service.php
693 /modules/an_client_service/translations/it.php
694 /modules/an_trust_badges/an_trust_badges.php
695 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php
696 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php
697 /modules/an_trust_badges/translations/it.php
698 /modules/an_user_testimonials/an_user_testimonials.php
699 /modules/an_user_testimonials/classes/AnUserTestimonials.php
700 /modules/an_user_testimonials/translations/it.php
701 /modules/an_accordion/an_accordion.php
702 /modules/an_accordion/classes/AnAccordionBlock.php
703 /modules/an_accordion/translations/it.php
704 /modules/an_homeslider/an_homeslider.php
705 /modules/an_homeslider/classes/anHomeSliderFiles.php
706 /modules/an_homeslider/classes/anHomeSlides.php
707 /modules/an_homeslider/classes/anHomeSliders.php
708 /modules/an_homeslider/hooks_ignore.php
709 /modules/an_homeslider/translations/it.php
710 /modules/an_homeproducts/an_homeproducts.php
711 /modules/an_homeproducts/classes/anHomeProductsBlocks.php
712 /modules/an_homeproducts/classes/anHomeProductFiles.php
713 /modules/an_homeproducts/classes/anHomeProductsBanners.php
714 /modules/an_homeproducts/translations/it.php
715 /modules/an_banners/an_banners.php
716 /modules/an_banners/classes/anBanners.php
717 /modules/an_banners/hooks_ignore.php
718 /modules/an_banners/translations/it.php
719 /modules/an_simplefreeshippingline/an_simplefreeshippingline.php
720 /modules/an_simplefreeshippingline/translations/it.php
721 /modules/an_homecategories/an_homecategories.php
722 /modules/an_homecategories/classes/anHomecatFiles.php
723 /modules/an_homecategories/classes/AnHomecategories.php
724 /modules/an_homecategories/translations/it.php
725 /modules/paypal/paypal.php
726 /modules/paypal/config_prod.php
727 /classes/PaymentModule.php
728 /modules/paypal/classes/Shortcut/ShortcutConfiguration.php
729 /modules/paypal/smarty/plugins/modifier.paypalreplace.php
730 /modules/paypal/translations/it.php
731 /modules/paypal/classes/Constants/PaypalConfigurations.php
732 /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php
733 /modules/paypal/classes/Constants/WebHookConf.php
734 /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php
735 /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php
736 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php
737 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php
738 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php
739 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php
740 /modules/paypal/diagnostic.php
741 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php
742 /modules/paypal/classes/AbstractMethodPaypal.php
743 /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php
744 /modules/paypal/classes/MethodEC.php
745 /modules/paypal/classes/WhiteList/WhiteListService.php
746 /modules/paypal/classes/API/PaypalApiManager.php
747 /modules/paypal/classes/API/PaypalApiManagerInterface.php
748 /modules/paypal/classes/API/PaypalVaultApiManagerInterface.php
749 /modules/paypal/classes/API/PaypalClient.php
750 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalHttpClient.php
751 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/HttpClient.php
752 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/ProductionEnvironment.php
753 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalEnvironment.php
754 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Environment.php
755 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Encoder.php
756 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Json.php
757 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer.php
758 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Text.php
759 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Multipart.php
760 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Form.php
761 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/AuthorizationInjector.php
762 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Injector.php
763 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/GzipInjector.php
764 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/FPTIInstrumentationInjector.php
765 /classes/Smarty/SmartyCustomTemplate.php
766 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
767 /var/cache/dev/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php
768 /modules/anscrolltop/anscrolltop.php
769 /modules/anscrolltop/translations/it.php
770 /modules/darkmode/darkmode.php
771 /src/Adapter/Localization/LegacyTranslator.php
772 /modules/darkmode/translations/it.php
773 /modules/eicaptcha/eicaptcha.php
774 /modules/eicaptcha/translations/it.php
775 /modules/eicaptcha/src/Debugger.php
776 /modules/mangayo_assistant/mangayo_assistant.php
777 /modules/mangayo_assistant/translations/it.php
778 /modules/facebookproductad/facebookproductad.php
779 /modules/facebookproductad/vendor/autoload.php
780 /modules/facebookproductad/vendor/composer/autoload_real.php
781 /modules/facebookproductad/vendor/composer/platform_check.php
782 /modules/facebookproductad/vendor/composer/autoload_static.php
783 /modules/facebookproductad/translations/it.php
784 /modules/facebookproductad/lib/moduleTools.php
785 /modules/facebookproductad/conf/moduleConfiguration.php
786 /modules/facebookproductad/lib/hook/hookController.php
787 /modules/facebookproductad/lib/hook/hookDisplay.php
788 /modules/facebookproductad/lib/hook/hookBase.php
789 /modules/facebookproductad/lib/dao/moduleDao.php
790 /modules/facebookproductad/lib/pixel/basePixel.php
791 /modules/facebookproductad/lib/pixel/pixelCategory.php
792 /classes/Combination.php
793 /classes/stock/StockAvailable.php
794 /classes/SpecificPrice.php
795 /classes/tax/TaxManagerFactory.php
796 /classes/tax/TaxRulesTaxManager.php
797 /classes/tax/TaxManagerInterface.php
798 /classes/tax/TaxCalculator.php
799 /classes/GroupReduction.php
800 /classes/Pack.php
801 /classes/Feature.php
802 /var/cache/dev/smarty/compile/charme/b3/c8/1a/b3c81a5ca82982e30cc717b20aaf37611d4de76f_2.file.header.tpl.php
803 /modules/an_brandslider/an_brandslider.php
804 /modules/an_brandslider/translations/it.php
805 /modules/an_megamenu/an_megamenu.php
806 /modules/an_megamenu/classes/AnMenu.php
807 /modules/an_megamenu/classes/AnDropdown.php
808 /classes/controller/AdminController.php
809 /modules/an_megamenu/composite/AnMegaMenuConfigurator.php
810 /modules/an_megamenu/composite/AnMegaMenuMenuConfigurator.php
811 /modules/an_megamenu/composite/AnMegaMenuHooks.php
812 /modules/an_megamenu/composite/AnMegaMenuAjaxHandler.php
813 /modules/an_megamenu/composite/AnMegaMenuDropDownConfigurator.php
814 /modules/an_productattributes/an_productattributes.php
815 /modules/an_productattributes/classes/anProductAttr.php
816 /modules/an_productattributes/translations/it.php
817 /var/cache/dev/smarty/compile/charme/ed/2e/b6/ed2eb6a7d481b95124e291b11541581f4431489e_2.file.js_header.tpl.php
818 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
819 /modules/an_wishlist/an_wishlist.php
820 /modules/an_wishlist/classes/an_wish.php
821 /modules/an_wishlist/classes/an_wish_products.php
822 /modules/an_wishlist/classes/an_wishListing.php
823 /modules/an_wishlist/translations/it.php
824 /modules/an_stickyaddtocart/an_stickyaddtocart.php
825 /modules/an_stickyaddtocart/translations/it.php
826 /modules/an_theme/an_theme.php
827 /modules/an_theme/classes/InputFactory.php
828 /modules/an_theme/classes/Input.php
829 /modules/an_theme/classes/Validation.php
830 /modules/an_theme/classes/antheme.php
831 /modules/an_theme/classes/anThemeFiles.php
832 /modules/an_theme/translations/it.php
833 /themes/charme/assets/antheme/config/theme_fonts.php
834 /themes/charme/assets/antheme/config/theme_js.php
835 /themes/charme/assets/antheme/config/theme_css.php
836 /themes/charme/assets/antheme/config/vars.php
837 /themes/charme/assets/antheme/config/fields.php
838 /modules/sociallogin/sociallogin.php
839 /modules/sociallogin/translations/it.php
840 /modules/ps_googleanalytics/ps_googleanalytics.php
841 /modules/ps_googleanalytics/vendor/autoload.php
842 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
843 /modules/ps_googleanalytics/vendor/composer/platform_check.php
844 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
845 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
846 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
847 /var/cache/dev/smarty/compile/charme/d2/a4/03/d2a40332993e3600f818db0d45a227f1af331e1a_2.file.ps_googleanalytics.tpl.php
848 /modules/luminage_mail/luminage_mail.php
849 /modules/luminage_mail/translations/it.php
850 /modules/hioutofstocknotification/hioutofstocknotification.php
851 /modules/hioutofstocknotification/classes/HiPrestaModule.php
852 /modules/hioutofstocknotification/classes/outofstock.php
853 /modules/hioutofstocknotification/classes/sentemail.php
854 /modules/hioutofstocknotification/classes/statistic.php
855 /modules/hioutofstocknotification/classes/oosnpdf.php
856 /classes/pdf/HTMLTemplate.php
857 /modules/hioutofstocknotification/classes/adminForms.php
858 /modules/hioutofstocknotification/translations/it.php
859 /var/cache/dev/smarty/compile/charme/b2/c3/47/b2c3472b487ed27b1e317c435a1d8b7f737453cb_2.file.header.tpl.php
860 /modules/ambjolisearch/ambjolisearch.php
861 /modules/ambjolisearch/classes/AmbJolisearchModule.php
862 /modules/ambjolisearch/classes/AmbIndexation.php
863 /modules/ambjolisearch/classes/AmbSearch.php
864 /modules/ambjolisearch/classes/definitions.php
865 /modules/ambjolisearch/classes/JoliLink.php
866 /modules/ambjolisearch/classes/JoliLink-1.7.php
867 /modules/ambjolisearch/classes/AmbJolisearchModuleProxy.php
868 /modules/ambjolisearch/translations/it.php
869 /modules/hicookielaw/hicookielaw.php
870 /modules/hicookielaw/classes/HiPrestaModule.php
871 /modules/hicookielaw/classes/adminForms.php
872 /modules/hicookielaw/classes/consent.php
873 /modules/hicookielaw/classes/type.php
874 /modules/hicookielaw/translations/it.php
875 /var/cache/dev/smarty/compile/charme/0c/8b/7b/0c8b7bc449184adb2e93a99131724c331ff4e737_2.file.header.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
877 /modules/payplug/payplug.php
878 /modules/payplug/translations/it.php
879 /modules/payplug/classes/PayPlugDependencies.php
880 /modules/payplug/classes/DependenciesClass.php
881 /modules/payplug/src/utilities/validators/accountValidator.php
882 /modules/payplug/src/utilities/validators/browserValidator.php
883 /modules/payplug/src/utilities/validators/cardValidator.php
884 /modules/payplug/src/utilities/validators/lockValidator.php
885 /modules/payplug/src/utilities/validators/loggerValidator.php
886 /modules/payplug/src/utilities/validators/moduleValidator.php
887 /modules/payplug/src/utilities/validators/orderValidator.php
888 /modules/payplug/src/utilities/validators/paymentValidator.php
889 /modules/payplug/src/utilities/helpers/AmountHelper.php
890 /modules/payplug/src/utilities/helpers/CookiesHelper.php
891 /modules/payplug/src/utilities/helpers/FilesHelper.php
892 /modules/payplug/src/utilities/helpers/PhoneHelper.php
893 /modules/payplug/src/utilities/helpers/UserHelper.php
894 /modules/payplug/src/application/dependencies/PluginInit.php
895 /modules/payplug/src/application/dependencies/BaseClass.php
896 /modules/payplug/src/actions/CardAction.php
897 /modules/payplug/src/actions/ConfigurationAction.php
898 /modules/payplug/src/actions/MerchantTelemetryAction.php
899 /modules/payplug/src/actions/OnboardingAction.php
900 /modules/payplug/src/actions/OrderStateAction.php
901 /modules/payplug/src/actions/PaymentAction.php
902 /modules/payplug/src/models/entities/CacheEntity.php
903 /modules/payplug/src/models/entities/OneyEntity.php
904 /modules/payplug/src/models/entities/PluginEntity.php
905 /modules/payplug/src/models/entities/OrderStateEntity.php
906 /modules/payplug/src/application/adapter/AddressAdapter.php
907 /modules/payplug/src/interfaces/AddressInterface.php
908 /modules/payplug/src/application/adapter/AssignAdapter.php
909 /modules/payplug/src/interfaces/AssignInterface.php
910 /modules/payplug/src/application/adapter/CarrierAdapter.php
911 /modules/payplug/src/interfaces/CarrierInterface.php
912 /classes/Carrier.php
913 /modules/payplug/src/application/adapter/CartAdapter.php
914 /modules/payplug/src/interfaces/CartInterface.php
915 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
916 /modules/payplug/src/interfaces/ConfigurationInterface.php
917 /modules/payplug/src/application/adapter/ConstantAdapter.php
918 /modules/payplug/src/interfaces/ConstantInterface.php
919 /modules/payplug/src/application/adapter/ContextAdapter.php
920 /modules/payplug/src/interfaces/ContextInterface.php
921 /modules/payplug/src/application/adapter/CountryAdapter.php
922 /modules/payplug/src/interfaces/CountryInterface.php
923 /modules/payplug/src/application/adapter/CurrencyAdapter.php
924 /modules/payplug/src/interfaces/CurrencyInterface.php
925 /modules/payplug/src/application/adapter/CustomerAdapter.php
926 /modules/payplug/src/interfaces/CustomerInterface.php
927 /modules/payplug/src/application/adapter/DispatcherAdapter.php
928 /modules/payplug/src/interfaces/DispatcherInterface.php
929 /modules/payplug/src/application/adapter/LanguageAdapter.php
930 /modules/payplug/src/interfaces/LanguageInterface.php
931 /modules/payplug/src/application/adapter/MediaAdapter.php
932 /modules/payplug/src/interfaces/MediaInterface.php
933 /modules/payplug/src/application/adapter/MessageAdapter.php
934 /modules/payplug/src/interfaces/MessageInterface.php
935 /modules/payplug/src/application/adapter/ModuleAdapter.php
936 /modules/payplug/src/interfaces/ModuleInterface.php
937 /modules/payplug/src/application/adapter/OrderAdapter.php
938 /modules/payplug/src/interfaces/OrderInterface.php
939 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
940 /modules/payplug/src/interfaces/OrderHistoryInterface.php
941 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
942 /modules/payplug/src/interfaces/OrderSlipInterface.php
943 /modules/payplug/src/application/adapter/OrderStateAdapter.php
944 /modules/payplug/src/interfaces/OrderStateInterface.php
945 /classes/order/OrderState.php
946 /modules/payplug/src/application/adapter/ProductAdapter.php
947 /modules/payplug/src/interfaces/ProductInterface.php
948 /modules/payplug/src/application/adapter/QueryAdapter.php
949 /modules/payplug/src/interfaces/QueryInterface.php
950 /modules/payplug/src/application/adapter/ShopAdapter.php
951 /modules/payplug/src/interfaces/ShopInterface.php
952 /modules/payplug/src/application/adapter/ToolsAdapter.php
953 /modules/payplug/src/interfaces/ToolsInterface.php
954 /modules/payplug/src/application/adapter/TranslationAdapter.php
955 /modules/payplug/src/interfaces/TranslationInterface.php
956 /modules/payplug/src/application/adapter/ValidateAdapter.php
957 /modules/payplug/src/interfaces/ValidateInterface.php
958 /modules/payplug/src/models/classes/ApiRest.php
959 /modules/payplug/src/models/classes/Configuration.php
960 /modules/payplug/src/models/classes/Country.php
961 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
962 /modules/payplug/src/models/classes/Translation.php
963 /modules/payplug/translations/en.php
964 /modules/payplug/src/models/repositories/CardRepository.php
965 /modules/payplug/src/models/repositories/QueryRepository.php
966 /modules/payplug/src/models/repositories/CacheRepository.php
967 /modules/payplug/src/models/repositories/CountryRepository.php
968 /modules/payplug/src/models/repositories/LockRepository.php
969 /modules/payplug/src/models/repositories/LoggerRepository.php
970 /modules/payplug/src/models/repositories/ModuleRepository.php
971 /modules/payplug/src/models/repositories/OrderRepository.php
972 /modules/payplug/src/models/repositories/OrderStateRepository.php
973 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
974 /modules/payplug/src/models/repositories/PaymentRepository.php
975 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
976 /modules/payplug/src/models/repositories/ShopRepository.php
977 /modules/payplug/classes/MyLogPHP.php
978 /modules/payplug/src/repositories/LoggerRepository.php
979 /modules/payplug/src/models/entities/LoggerEntity.php
980 /modules/payplug/src/repositories/TranslationsRepository.php
981 /modules/payplug/src/repositories/SQLtableRepository.php
982 /modules/payplug/src/repositories/CacheRepository.php
983 /modules/payplug/src/repositories/OneyRepository.php
984 /modules/payplug/src/repositories/OrderStateRepository.php
985 /modules/payplug/src/repositories/InstallRepository.php
986 /modules/payplug/src/utilities/services/Browser.php
987 /modules/payplug/src/utilities/services/Routes.php
988 /modules/payplug/src/utilities/services/MerchantTelemetry.php
989 /modules/payplug/classes/ApiClass.php
990 /modules/payplug/classes/ApplePayClass.php
991 /modules/payplug/classes/AmountCurrencyClass.php
992 /modules/payplug/classes/AdminClass.php
993 /modules/payplug/classes/PayplugLock.php
994 /modules/payplug/classes/CartClass.php
995 /modules/payplug/classes/ConfigClass.php
996 /modules/payplug/classes/InstallmentClass.php
997 /modules/payplug/classes/HookClass.php
998 /modules/payplug/classes/MediaClass.php
999 /modules/payplug/classes/OrderClass.php
1000 /modules/payplug/classes/PaymentClass.php
1001 /modules/payplug/classes/RefundClass.php
1002 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1003 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1004 /var/cache/dev/smarty/compile/charme/6a/fd/5e/6afd5effcf983f0813cac21afbfc06523d64a8ee_2.file.messages.tpl.php
1005 /modules/app_endpoint/app_endpoint.php
1006 /modules/app_endpoint/translations/it.php
1007 /modules/codwfeeplus/codwfeeplus.php
1008 /modules/codwfeeplus/CODwFP.php
1009 /modules/codwfeeplus/translations/it.php
1010 /src/Core/Product/Search/ProductSearchContext.php
1011 /src/Core/Product/Search/ProductSearchQuery.php
1012 /src/Core/Product/Search/SortOrder.php
1013 /modules/ps_facetedsearch/ps_facetedsearch.php
1014 /modules/ps_facetedsearch/src/HookDispatcher.php
1015 /modules/ps_facetedsearch/src/Hook/Attribute.php
1016 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1017 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1018 /modules/ps_facetedsearch/src/Hook/Category.php
1019 /modules/ps_facetedsearch/src/Hook/Configuration.php
1020 /modules/ps_facetedsearch/src/Hook/Design.php
1021 /modules/ps_facetedsearch/src/Hook/Feature.php
1022 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1023 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1024 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1025 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1026 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1027 /modules/ps_facetedsearch/src/Hook/Product.php
1028 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1029 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1030 /modules/ps_facetedsearch/src/Filters/Provider.php
1031 /modules/ps_facetedsearch/src/URLSerializer.php
1032 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1033 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1034 /src/Core/Product/Search/FacetsRendererInterface.php
1035 /src/Core/Product/Search/ProductSearchProviderInterface.php
1036 /modules/ps_facetedsearch/src/Filters/Converter.php
1037 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1038 /modules/ambjolisearch/src/Amb_ProductSearchProvider.php
1039 /src/Core/Product/Search/ProductSearchResult.php
1040 /modules/ps_facetedsearch/src/Product/Search.php
1041 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1042 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1043 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1044 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1045 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1046 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1047 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1048 /modules/ps_facetedsearch/src/Filters/Products.php
1049 /modules/ps_facetedsearch/src/Filters/Block.php
1050 /src/Core/Product/Search/Facet.php
1051 /src/Core/Product/Search/Filter.php
1052 /src/Core/Product/Search/FacetCollection.php
1053 /classes/ProductAssembler.php
1054 /classes/ProductPresenterFactory.php
1055 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1056 /src/Adapter/Presenter/Product/ProductPresenter.php
1057 /src/Adapter/Product/ProductColorsRetriever.php
1058 /src/Adapter/HookManager.php
1059 /src/Core/Product/ProductPresentationSettings.php
1060 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1061 /src/Adapter/Presenter/Product/ProductLazyArray.php
1062 /src/Adapter/Presenter/AbstractLazyArray.php
1063 /classes/Image.php
1064 /src/Core/Image/ImageFormatConfiguration.php
1065 /src/Core/Image/ImageFormatConfigurationInterface.php
1066 /classes/FeatureFlag.php
1067 /src/Core/FeatureFlag/FeatureFlagSettings.php
1068 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1069 /vendor/prestashop/decimal/src/Operation/Addition.php
1070 /src/Core/Util/Inflector.php
1071 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1072 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1073 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1074 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1075 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1076 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1077 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1078 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1079 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1080 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1081 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1082 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1083 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1084 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1085 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1086 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1087 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1088 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1089 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1090 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1091 /var/cache/dev/smarty/compile/charme/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1093 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1094 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1095 /var/cache/dev/smarty/compile/charme/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1096 /src/Core/Product/Search/Pagination.php
1097 /modules/sociallogin/models/SocialLoginPosition.php
1098 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/66/81/f1/6681f1287ad4751f4330999bf7e5047ef3e52cec_2.file.category.tpl.php
1099 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ee/8c/21/ee8c21f25c301be5b9dae26ba3672f4427c6aeb2_2.file.product-list.tpl.php
1100 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/c1/e5/02/c1e502525a49748091427e0df780f90846bd9d90_2.file.layout-left-column.tpl.php
1101 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a2/43/0d/a2430dfc6da9bb5b779a9919d46af9cb98017def_2.file.layout-both-columns.tpl.php
1102 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a0/b9/f1/a0b9f11bc34eb90e03108a3780da705e4c424c76_2.file.head.tpl.php
1103 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5c/99/24/5c9924d502b61764c40eeba7cd7dda269692307d_2.file.stylesheets.tpl.php
1104 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/3b/3c/ff/3b3cff40db7c22a4ee30c69b5f51819b85be6d9c_2.file.preload.tpl.php
1105 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ad/54/e6/ad54e66984a22371c20ef3cde2b3e98bd215d8e8_2.file.javascript.tpl.php
1106 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/fd/59/0a/fd590a6b567acb629cd24ef142a6acc3994b20dd_2.file.product-activation.tpl.php
1107 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/6b/40/6a/6b406af67655c04b1b8bc34738282cebbf0034fb_2.file.header.tpl.php
1108 /var/cache/dev/smarty/compile/charme/ba/f0/71/baf0714d120e11446c0237301b6cccbc40531653_2.module.an_simplefreeshippinglineviewstemplatesfrontwidget.tpl.php
1109 /modules/ps_languageselector/ps_languageselector.php
1110 /modules/ps_currencyselector/ps_currencyselector.php
1111 /var/cache/dev/smarty/compile/charme/49/36/e5/4936e564782a528c3079f559922e796453f1af1a_2.module.an_client_serviceviewstemplatesfrontwidget.tpl.php
1112 /modules/darkmode/src/Model/DarkModeOptionsModel.php
1113 /modules/darkmode/src/Db/QueryBuilder.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_clearcache.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1116 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1117 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_cacheresourcefile.php
1118 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1120 /var/cache/dev/smarty/compile/charme/a3/cf/9f/a3cf9f8dbcef1e72a52283b913857be8db6a8b80_2.module.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.cache.php
1121 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1122 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1123 /var/cache/dev/smarty/cache/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php
1124 /modules/ps_customersignin/ps_customersignin.php
1125 /var/cache/dev/smarty/compile/charme/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1126 /src/Core/Security/OpenSsl/OpenSSL.php
1127 /src/Core/Security/OpenSsl/OpenSSLInterface.php
1128 /var/cache/dev/smarty/compile/charme/62/b3/ea/62b3ea25f9be6f347bb81fe6309b35116e17553f_2.module.an_wishlistviewstemplatesfrontnav.tpl.php
1129 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1130 /var/cache/dev/smarty/compile/charme/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1131 /modules/an_logo/an_logo.php
1132 /modules/an_logo/translations/it.php
1133 /var/cache/dev/smarty/compile/charme/74/96/d2/7496d2b81ba6ced33a36c630e03cb86d3b647a4b_2.module.an_logoviewstemplatesfrontlogo.tpl.php
1134 /var/cache/dev/smarty/compile/charme/bd/eb/23/bdeb239cddb118da7e29251e756fe96cb3dbe26b_2.file.an_megamenu.tpl.cache.php
1135 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php
1136 /var/cache/dev/smarty/compile/charme/11/0e/c7/110ec72aa9921d2c382ad628bdb2f0bc5105a617_2.module.ps_searchbarps_searchbar.tpl.php
1137 /var/cache/dev/smarty/compile/charme/6a/4b/17/6a4b178cc6ac5016a51cc4db2dda74b30a8cd612_2.file.an_megamenu_mobile.tpl.cache.php
1138 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php
1139 /modules/paypal/classes/InstallmentBanner/BannerManager.php
1140 /modules/paypal/classes/InstallmentBanner/Banner.php
1141 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/b6/b4/37/b6b437561c01fc88997451a413028764044621b6_2.file.notifications.tpl.php
1142 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5b/7f/12/5b7f12aebdf137ed79e78dddcd112712d43e20b5_2.file.breadcrumb.tpl.php
1143 /modules/ps_categorytree/ps_categorytree.php
1144 /var/cache/dev/smarty/compile/charme/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1145 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1146 /var/cache/dev/smarty/compile/charme/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1147 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/22/46/68/2246682b55d5939ba2438c9cba4d4cef07b7d99c_2.file.products-top.tpl.php
1148 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/e7/d5/5d/e7d55de2607b7a3747d835209dfa0bf329274823_2.file.sort-orders.tpl.php
1149 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/cc/2a/92/cc2a920e103307f38418741dbd6eeb78d4f4244b_2.file.products.tpl.php
1150 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/64/de/36/64de36afa8ae49504410858f9ee0be9233599a2b_2.file.product.tpl.php
1151 /var/cache/dev/smarty/compile/charme/62/77/7b/62777bbf995f423da45bdc9d94b3b2255e0685b7_2.module.an_wishlistviewstemplatesfrontproductminiature.tpl.php
1152 /var/cache/dev/smarty/compile/charme/b8/c2/d3/b8c2d37a7784d2c0bb28c4512a21f9b34473d1ad_2.file.productattributes.tpl.php
1153 /var/cache/dev/smarty/compile/charme/c2/f6/38/c2f6388ad4d70d04993a1b28e28ed73fbe5270a8_2.module.an_productattributesviewstemplatesfrontproductattributeswrapper.tpl.php
1154 /var/cache/dev/smarty/compile/charme/50/e3/6e/50e36e4f3c2a4795be15b313ca9e72dc460a5959_2.file.product-variants.tpl.php
1155 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a9/33/f4/a933f46e6d0f30297d17cc3e63762fa9de0d686c_2.file.pagination.tpl.php
1156 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/03/b6/70/03b67016d311f010e0c867f508f78946bb5f1315_2.file.products-bottom.tpl.php
1157 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/38/2a/57/382a577075ddb0537c28ca99407fca0d658514ed_2.file.footer.tpl.php
1158 /modules/ps_contactinfo/ps_contactinfo.php
1159 /var/cache/dev/smarty/compile/charme/99/92/f3/9992f3fe04dd41bcec1a2029cf07bead637caf4d_2.module.ps_contactinfops_contactinfo.tpl.php
1160 /modules/ps_linklist/ps_linklist.php
1161 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php
1162 /modules/ps_linklist/src/Filter/LinkFilter.php
1163 /modules/ps_linklist/src/Filter/BestSalesRouteFilter.php
1164 /modules/ps_linklist/src/Filter/RouteFilterInterface.php
1165 /modules/ps_linklist/src/LegacyLinkBlockRepository.php
1166 /modules/ps_linklist/src/Model/LinkBlock.php
1167 /classes/CMS.php
1168 /var/cache/dev/smarty/compile/charme/90/65/48/906548e89c8c6025457ddaeffb1980a0c743b872_2.module.ps_linklistviewstemplateshooklinkblock.tpl.cache.php
1169 /var/cache/dev/smarty/cache/ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php
1170 /var/cache/dev/smarty/compile/charme/94/04/dd/9404dddf9d62e01629bc90a9cb65c9dd834a2134_2.module.darkmodeviewstemplatesfrontdarkmode_functions.tpl.cache.php
1171 /var/cache/dev/smarty/cache/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php
1172 /modules/ps_customeraccountlinks/ps_customeraccountlinks.php
1173 /var/cache/dev/smarty/compile/charme/42/f9/46/42f9461127ce7396a601c2484841253ea5ba658f_2.module.ps_customeraccountlinksps_customeraccountlinks.tpl.cache.php
1174 /var/cache/dev/smarty/cache/ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php
1175 /var/cache/dev/smarty/compile/charme/b7/0c/56/b70c564919bbf154e7811f43c0a130bb3dc49f9f_2.file.display_footer.tpl.php
1176 /modules/an_copyright/an_copyright.php
1177 /modules/an_copyright/translations/it.php
1178 /var/cache/dev/smarty/compile/charme/56/a5/c8/56a5c82cce1796d8dbfa7b0b327052e3fece4682_2.module.an_copyrightviewstemplatesfrontwidget.tpl.php
1179 /var/cache/dev/smarty/compile/charme/31/32/2b/31322b94623342814b8c7d4182cfda837762840e_2.module.an_trust_badgesviewstemplatesfrontwidget.tpl.php
1180 /modules/statsdata/statsdata.php
1181 /classes/Guest.php
1182 /classes/Connection.php
1183 /classes/Page.php
1184 /classes/ConnectionsSource.php
1185 /classes/DateRange.php
1186 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1187 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1188 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1189 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1190 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1191 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1192 /var/cache/dev/smarty/compile/charme/9b/b4/49/9bb449ecf8392afc0ebd444efd0e58f7f03bd397_2.file.ga_tag.tpl.php