Manga (3)

Manga

Tutti i manga sono protetti in una perfetta bustina protettiva su misura.

Filtri attivi

  • Genere: Drammatico
  • Genere: Gang Giovanili
  • Genere: Harem
  • Genere: Raccolta

Black Jack - Osamushi...

9,60 € 12,00 €

Black Jack - Osamushi Collection Volumi: 7 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 15x21 Editore: JPOP Lingua: Italiano

Black Jack - Osamushi...

9,60 € 12,00 €

Black Jack - Osamushi Collection Volumi: 4 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 15x21 Editore: JPOP Lingua: Italiano

Black Jack - Osamushi...

9,60 € 12,00 €

Black Jack - Osamushi Collection Volumi: 3 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 15x21 Editore: JPOP Lingua: Italiano

Black Jack - Osamushi...

9,60 € 12,00 €

Black Jack - Osamushi Collection Volumi: 2 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 15x21 Editore: JPOP Lingua: Italiano

L'Attacco dei Giganti 28

4,66 € 4,90 €

L'Attacco dei Giganti  Volume: 28 Storia: Hajime Isayama Disegni: Hajime Isayama Formato: 11.5x17.5 Editore: Planet Manga Lingua: Italiano

Black Jack Neo 2

4,72 € 5,90 €

Black Jack Neo Volumi: 2 Storia: Osamu Tezuka Disegni: Masayuki Taguchi Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Buddha 2

11,20 € 14,00 €

Buddha Volume: 2 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Buddha 3

11,20 € 14,00 €

Buddha Volume: 3 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Buddha 4

11,20 € 14,00 €

Buddha Volume: 4 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Buddha 7

11,20 € 14,00 €

Buddha Volume: 7 Storia: Osamu Tezuka Disegni: Osamu Tezuka Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Vagabond Deluxe 15

6,65 € 7,00 €

Vagabond Deluxe Volume: 15 Storia: Takehiko Inoue Disegni: Takehiko Inoue Formato: 13x18 Editore: Planet Manga Lingua: Italiano

Cannibale

11,20 € 14,00 €

Cannibale Volumi: Unico Storia: Yu Aku Disegni: Kazuo Kamimura Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Record of Ragnarok 1

6,18 € 6,50 €

Record of Ragnarok Volume: 1 Storia: Takumi Fukui, Shinya Umemura Disegni: Chika Aji Formato: 13x18 Editore: Star Comics Lingua: Italiano

Record of Ragnarok 2

6,18 € 6,50 €

Record of Ragnarok Volume: 2 Storia: Takumi Fukui, Shinya Umemura Disegni: Chika Aji Formato: 13x18 Editore: Star Comics Lingua: Italiano

Vagabond Deluxe 16

6,65 € 7,00 €

Vagabond Deluxe Volume: 16 Storia: Takehiko Inoue Disegni: Takehiko Inoue Formato: 13x18 Editore: Planet Manga Lingua: Italiano

Vagabond Deluxe 17

6,65 € 7,00 €

Vagabond Deluxe Volume: 17 Storia: Takehiko Inoue Disegni: Takehiko Inoue Formato: 13x18 Editore: Planet Manga Lingua: Italiano

Vagabond Deluxe 20

6,65 € 7,00 €

Vagabond Deluxe Volume: 20 Storia: Takehiko Inoue Disegni: Takehiko Inoue Formato: 13x18 Editore: Planet Manga Lingua: Italiano

Vagabond Deluxe 30

6,65 € 7,00 €

Vagabond Deluxe Volume: 30 Storia: Takehiko Inoue Disegni: Takehiko Inoue Formato: 13x18 Editore: Planet Manga Lingua: Italiano

Caste Heaven 8

5,52 € 6,90 €

Caste Heaven Volume: 8 Storia: Chise Ogawa Disegni: Chise Ogawa Formato: 12.5x16.9 Editore: JPOP Lingua: Italiano

Vagabond Deluxe 33

6,65 € 7,00 €

Vagabond Deluxe Volume: 33 Storia: Takehiko Inoue Disegni: Takehiko Inoue Formato: 13x18 Editore: Planet Manga Lingua: Italiano

Chocolatier - Cioccolata...

6,00 € 7,50 €

Chocolatier - Cioccolata per un cuore spezzato Volume: 1 Storia: Setona Mizushiro Disegni: Setona Mizushiro Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Chocolatier - Cioccolata...

6,00 € 7,50 €

Chocolatier - Cioccolata Per Un Cuore Spezzato Volume: 3 Storia: Setona Mizushiro Disegni: Setona Mizushiro Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Chocolatier - Cioccolata...

6,00 € 7,50 €

Chocolatier - Cioccolata Per Un Cuore Spezzato Volume: 6 Storia: Setona Mizushiro Disegni: Setona Mizushiro Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Chocolatier - Cioccolata...

6,00 € 7,50 €

Chocolatier - Cioccolata Per Un Cuore Spezzato Volume: 7 Storia: Setona Mizushiro Disegni: Setona Mizushiro Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Load Time 1575 ms
Querying Time 1435 ms
Queries 1135
Memory Peak Usage 30.8 Mb
Included Files 1193 files - 12.42 Mb
PrestaShop Cache - Mb
Global vars 0.37 Mb
PrestaShop Version 8.1.2
PHP Version 8.1.27
MySQL Version 10.5.11-MariaDB-1:10.5.11+maria~buster-log
Memory Limit 512M
Max Execution Time 60s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 2.182 ms 2.182 ms 2.88 Mb 3.2 Mb
__construct 0.010 ms 2.192 ms - Mb 3.2 Mb
init 13.111 ms 15.303 ms 0.50 Mb 3.5 Mb
checkAccess 0.001 ms 15.304 ms - Mb 3.5 Mb
setMedia 2.040 ms 17.344 ms 0.10 Mb 3.5 Mb
postProcess 0.001 ms 17.345 ms - Mb 3.5 Mb
initHeader 0.000 ms 17.345 ms - Mb 3.5 Mb
initContent 1244 ms 1261 ms 11.57 Mb 15.2 Mb
initFooter 0.000 ms 1261 ms - Mb 15.2 Mb
display 314.324 ms 1575 ms 15.09 Mb 30.8 Mb
Hook Time Memory Usage
DisplayHeader 235.971 ms 4.83 Mb
DisplayProductPriceBlock 113.230 ms 6.22 Mb
displayFooter 41.960 ms 1.39 Mb
displayProductListReviews 24.872 ms 1.74 Mb
ActionProductFlagsModifier 23.838 ms 1.73 Mb
DisplayBeforeBodyClosingTag 17.338 ms 0.40 Mb
displayNav2 15.125 ms 0.41 Mb
Header 12.809 ms 0.37 Mb
DisplayTop 11.180 ms 0.37 Mb
DisplayMobileMenu 10.810 ms 0.40 Mb
DisplayFooter 10.456 ms 0.07 Mb
displayCopyrightContainer 2.038 ms 0.09 Mb
displayLeftColumn 2.007 ms 0.06 Mb
displayNav1 1.683 ms 0.11 Mb
displayNavFullWidth 1.233 ms 0.08 Mb
DisplayOverrideTemplate 1.120 ms 0.03 Mb
displayCopyrightContainerLeft 1.073 ms 0.06 Mb
displayTopLeft 0.892 ms 0.04 Mb
displayClientService 0.806 ms 0.06 Mb
displayBanner 0.802 ms 0.04 Mb
DisplayNavFullWidth 0.516 ms 0.03 Mb
displayTopRight 0.156 ms - Mb
ActionFrontControllerSetMedia 0.155 ms 0.01 Mb
displayFooterLogo 0.097 ms - Mb
ProductSearchProvider 0.096 ms - Mb
DisplayLeftColumn 0.090 ms 0.07 Mb
ModuleRoutes 0.008 ms - Mb
27 hook(s) 530.362 ms 18.60 Mb
Module Time Memory Usage
anblog 1.741 ms 0.02 Mb
ps_emailsubscription 1.172 ms 0.08 Mb
ps_socialfollow 0.074 ms 0.01 Mb
ps_emailalerts 0.111 ms 0.01 Mb
ps_shoppingcart 0.995 ms 0.06 Mb
ets_crosssell 29.908 ms 0.18 Mb
ps_searchbar 0.317 ms 0.01 Mb
an_productextratabs 23.966 ms 1.75 Mb
an_client_service 0.895 ms 0.07 Mb
an_trust_badges 2.123 ms 0.09 Mb
an_user_testimonials 0.139 ms 0.01 Mb
an_accordion 0.097 ms 0.01 Mb
an_homeslider 0.152 ms 0.01 Mb
an_homeproducts 0.167 ms 0.01 Mb
an_banners 0.100 ms 0.01 Mb
an_simplefreeshippingline 0.893 ms 0.05 Mb
an_homecategories 0.102 ms 0.01 Mb
paypal 2.096 ms 0.23 Mb
anscrolltop 0.233 ms 0.06 Mb
darkmode 21.793 ms 0.36 Mb
eicaptcha 0.111 ms - Mb
mangayo_assistant 0.108 ms 0.01 Mb
facebookproductad 204.400 ms 4.63 Mb
an_brandslider 10.784 ms 0.14 Mb
an_megamenu 22.321 ms 0.83 Mb
an_productattributes 112.691 ms 6.13 Mb
an_wishlist 26.665 ms 1.85 Mb
an_stickyaddtocart 0.089 ms 0.01 Mb
an_theme 1.216 ms 0.10 Mb
sociallogin 4.567 ms 0.14 Mb
ps_googleanalytics 3.212 ms 0.13 Mb
luminage_mail 0.123 ms 0.01 Mb
hioutofstocknotification 0.428 ms 0.03 Mb
ambjolisearch 10.224 ms 0.26 Mb
hicookielaw 1.366 ms 0.04 Mb
payplug 4.845 ms 0.44 Mb
app_endpoint 0.119 ms 0.01 Mb
codwfeeplus 2.323 ms 0.15 Mb
ps_facetedsearch 0.361 ms 0.12 Mb
ps_languageselector 0.708 ms 0.05 Mb
ps_currencyselector 1.087 ms 0.07 Mb
ps_customersignin 1.118 ms 0.07 Mb
an_logo 1.121 ms 0.05 Mb
ps_categorytree 2.061 ms 0.07 Mb
ps_contactinfo 1.821 ms 0.09 Mb
ps_linklist 26.031 ms 1.02 Mb
ps_customeraccountlinks 4.272 ms 0.18 Mb
an_copyright 1.207 ms 0.06 Mb
statsdata 14.371 ms 0.30 Mb
49 module(s) 546.824 ms 19.98 Mb

Stopwatch SQL - 1135 queries

# Query Time (ms) Rows Filesort Group By Location
384
SELECT SQL_NO_CACHE p.id_product, sa.out_of_stock FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY IFNULL(p.quantity, 0) <= 0, IFNULL(p.quantity, 0) <= 0 AND FIELD(sa.out_of_stock, 1) DESC, p.position ASC, p.id_product DESC LIMIT 48, 24
220.435 ms 2515585400832 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
386
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=3)) AND ((fp_1.id_feature_value IN (15, 80, 55, 68))) GROUP BY fp.id_feature_value
158.309 ms 51060101120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
388
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=4)) GROUP BY fp.id_feature_value
146.380 ms 17805365760 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
385
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68)))
124.089 ms 5864481280 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
393
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM mangayo_product p INNER JOIN mangayo_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28
88.412 ms 2336 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
392
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND cg.id_group='1' AND c.nleft>11 AND c.nright<28 GROUP BY cp.id_category
54.554 ms 457856 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1131
SELECT SQL_NO_CACHE `id_date_range`, `time_end`
FROM `mangayo_date_range`
WHERE `time_end` = (SELECT MAX(`time_end`) FROM `mangayo_date_range`) LIMIT 1
9.157 ms 91431844 /classes/DateRange.php:60
728
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
6.332 ms 1 /classes/Smarty/SmartyCustom.php:280
1107
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
6.088 ms 1 /classes/Smarty/SmartyCustom.php:280
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `mangayo_configuration` c
LEFT JOIN `mangayo_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
5.543 ms 2039 /classes/Configuration.php:180
906
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 595) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
3.983 ms 1 /classes/stock/StockAvailable.php:778
79
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `mangayo_hook_module` hm
STRAIGHT_JOIN `mangayo_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `mangayo_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
3.879 ms 610 /classes/Hook.php:456
222
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
3.480 ms 1 /classes/SpecificPrice.php:259
78
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `mangayo_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `mangayo_hook_alias` ha
INNER JOIN `mangayo_hook` h ON ha.name = h.name
3.360 ms 0 /classes/Hook.php:1292
246
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 299)
3.298 ms 1 /classes/Product.php:3857
65
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-06-28 00:00:00",
INTERVAL 10 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `mangayo_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `mangayo_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `mangayo_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `mangayo_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `mangayo_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 11 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
3.200 ms 11258 /classes/Category.php:1059
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `mangayo_module` m
INNER JOIN mangayo_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `mangayo_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `mangayo_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `mangayo_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2.781 ms 182 Yes Yes /classes/Hook.php:1233
245
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 299) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
2.534 ms 2 Yes /classes/SpecificPrice.php:576
1134
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `mangayo_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (5877,4129,3501,2765,405,9260,4911,5694,6292,7920,595,4131,596,597,599,600,602,604,6533,606,4997,6293,7797,8527) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
1.992 ms 68 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
347
SHOW TABLES LIKE "%mangayo_social_login_%"
1.870 ms 1 /modules/sociallogin/sociallogin.php:186
905
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 595 LIMIT 1
1.811 ms 75 /modules/an_wishlist/classes/an_wish_products.php:124
394
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-06-28 00:00:00',
INTERVAL 10 DAY
)
) > 0) as new
FROM mangayo_product p
LEFT JOIN mangayo_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN mangayo_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN mangayo_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (5877,4129,3501,2765,405,9260,4911,5694,6292,7920,595,4131,596,597,599,600,602,604,6533,606,4997,6293,7797,8527)
1.747 ms 24 /classes/ProductAssembler.php:95
390
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (15, 80, 55, 68))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=5)) AND ((fp_1.id_feature_value IN (15, 80, 55, 68))) GROUP BY fp.id_feature_value
1.682 ms 448 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
40
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
1.680 ms 178 /classes/CartRule.php:418
221
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 297) AND (b.`id_shop` = 1) LIMIT 1
1.632 ms 1 /src/Adapter/EntityMapper.php:71
851
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 9260
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.549 ms 2 Yes Yes /classes/Product.php:4578
911
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 595
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.526 ms 2 Yes Yes /classes/Product.php:4578
791
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5877
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.510 ms 2 Yes Yes /classes/Product.php:4578
899
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7920
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.500 ms 2 Yes Yes /classes/Product.php:4578
863
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4911
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.497 ms 2 Yes Yes /classes/Product.php:4578
947
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 597
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.492 ms 2 Yes Yes /classes/Product.php:4578
839
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 405
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.489 ms 2 Yes Yes /classes/Product.php:4578
959
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 599
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.487 ms 2 Yes Yes /classes/Product.php:4578
803
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4129
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.484 ms 2 Yes Yes /classes/Product.php:4578
1007
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6533
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.484 ms 2 Yes Yes /classes/Product.php:4578
875
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5694
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.480 ms 2 Yes Yes /classes/Product.php:4578
827
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 2765
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.467 ms 2 Yes Yes /classes/Product.php:4578
1019
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 606
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.464 ms 2 Yes Yes /classes/Product.php:4578
971
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 600
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.459 ms 2 Yes Yes /classes/Product.php:4578
923
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4131
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.457 ms 2 Yes Yes /classes/Product.php:4578
935
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 596
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.455 ms 2 Yes Yes /classes/Product.php:4578
887
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6292
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.449 ms 2 Yes Yes /classes/Product.php:4578
1031
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4997
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.443 ms 2 Yes Yes /classes/Product.php:4578
815
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3501
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.439 ms 2 Yes Yes /classes/Product.php:4578
1055
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7797
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.435 ms 2 Yes Yes /classes/Product.php:4578
1067
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8527
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.431 ms 2 Yes Yes /classes/Product.php:4578
983
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 602
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.430 ms 2 Yes Yes /classes/Product.php:4578
995
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 604
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.425 ms 2 Yes Yes /classes/Product.php:4578
1043
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6293
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.398 ms 2 Yes Yes /classes/Product.php:4578
58
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
1.379 ms 40 Yes /classes/Manufacturer.php:211
1088
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 3 AND `id_shop` = 1
1.334 ms 1 /src/Adapter/EntityMapper.php:79
33
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `mangayo_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 11
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.302 ms 7 Yes Yes /classes/Category.php:921
1094
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 8 AND `id_shop` = 1
1.280 ms 1 /src/Adapter/EntityMapper.php:79
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `mangayo_hook`
1.271 ms 986 /classes/Hook.php:1292
113
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 287) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.245 ms 2 Yes /classes/SpecificPrice.php:576
333
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 307) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.229 ms 2 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 301) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.217 ms 2 Yes /classes/SpecificPrice.php:576
168
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 292) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.214 ms 2 Yes /classes/SpecificPrice.php:576
102
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 286) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.209 ms 2 Yes /classes/SpecificPrice.php:576
135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 289) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.205 ms 2 Yes /classes/SpecificPrice.php:576
250
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 299 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.197 ms 0 /classes/Cart.php:1410
124
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 288) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.193 ms 2 Yes /classes/SpecificPrice.php:576
179
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 293) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.190 ms 2 Yes /classes/SpecificPrice.php:576
311
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 305) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.190 ms 2 Yes /classes/SpecificPrice.php:576
190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 294) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.189 ms 2 Yes /classes/SpecificPrice.php:576
146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 290) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.186 ms 2 Yes /classes/SpecificPrice.php:576
322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 306) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.186 ms 2 Yes /classes/SpecificPrice.php:576
201
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 295) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.173 ms 2 Yes /classes/SpecificPrice.php:576
300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 304) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.159 ms 2 Yes /classes/SpecificPrice.php:576
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `mangayo_hook` h
WHERE (h.active = 1)
1.143 ms 986 /classes/Hook.php:1332
234
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 298) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.136 ms 2 Yes /classes/SpecificPrice.php:576
157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 291) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.130 ms 2 Yes /classes/SpecificPrice.php:576
278
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 302) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.121 ms 2 Yes /classes/SpecificPrice.php:576
91
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 285) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.112 ms 2 Yes /classes/SpecificPrice.php:576
223
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 297) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.110 ms 2 Yes /classes/SpecificPrice.php:576
752
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
1.108 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
212
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 296) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.098 ms 2 Yes /classes/SpecificPrice.php:576
1070
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
1.096 ms 40 Yes /classes/Manufacturer.php:211
256
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 300) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.088 ms 2 Yes /classes/SpecificPrice.php:576
289
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 303) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.064 ms 2 Yes /classes/SpecificPrice.php:576
767
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
1.062 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
1096
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 9 AND `id_shop` = 1
1.057 ms 1 /src/Adapter/EntityMapper.php:79
75
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 284) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.020 ms 2 Yes /classes/SpecificPrice.php:576
374
SELECT SQL_NO_CACHE t.*,
tl.*
FROM `mangayo_hicookietype` t
LEFT JOIN `mangayo_hicookietype_lang` `tl` ON t.`id_type` = tl.`id_type`
LEFT JOIN `mangayo_hicookietype_shop` `ts` ON t.`id_type` = ts.`id_type`
WHERE (tl.`id_lang` = 1) AND (ts.`id_shop` = 1)
ORDER BY t.position
1.013 ms 9 Yes /modules/hicookielaw/classes/type.php:68
383
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
1.007 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
778
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `mangayo_category` c
INNER JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `mangayo_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 6
AND nleft >= 11 AND nright <= 28
AND c.id_category IN (
SELECT id_category
FROM `mangayo_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cs.`position` ASC
1.005 ms 9 Yes /modules/ps_categorytree/ps_categorytree.php:166
18
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `mangayo_meta` m
LEFT JOIN `mangayo_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.970 ms 59 Yes /classes/Dispatcher.php:654
228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 297 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.954 ms 0 /classes/Cart.php:1410
85
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 284
ORDER BY f.position ASC
0.934 ms 7 Yes /classes/Product.php:5993
272
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 301 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 301 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.921 ms 0 /classes/Cart.php:1410
261
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 300 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 300 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.911 ms 0 /classes/Cart.php:1410
100
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 286) AND (b.`id_shop` = 1) LIMIT 1
0.907 ms 1 /src/Adapter/EntityMapper.php:71
239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 298 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.906 ms 0 /classes/Cart.php:1410
217
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 296 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.900 ms 0 /classes/Cart.php:1410
338
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 307 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.900 ms 0 /classes/Cart.php:1410
84
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 284 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.898 ms 0 /classes/Cart.php:1410
327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 306 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.897 ms 0 /classes/Cart.php:1410
129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 288 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 288 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.895 ms 0 /classes/Cart.php:1410
184
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 293 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.894 ms 0 /classes/Cart.php:1410
151
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 290 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 290 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.893 ms 0 /classes/Cart.php:1410
37
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.892 ms 130 /classes/module/Module.php:345
162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 291 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 291 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.892 ms 0 /classes/Cart.php:1410
294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 303 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.892 ms 0 /classes/Cart.php:1410
283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 302 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.891 ms 0 /classes/Cart.php:1410
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.890 ms 130 /classes/module/Module.php:345
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 304 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.889 ms 0 /classes/Cart.php:1410
107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 286 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.883 ms 0 /classes/Cart.php:1410
316
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 305 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.883 ms 0 /classes/Cart.php:1410
173
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 292 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 292 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.879 ms 0 /classes/Cart.php:1410
96
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 285 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.878 ms 0 /classes/Cart.php:1410
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 289 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 289 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.877 ms 0 /classes/Cart.php:1410
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 294 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 294 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.869 ms 0 /classes/Cart.php:1410
108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 286
ORDER BY f.position ASC
0.868 ms 7 Yes /classes/Product.php:5993
382
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `mangayo_feature` f  INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `mangayo_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `mangayo_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.860 ms 49 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
118
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 287 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.858 ms 0 /classes/Cart.php:1410
130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 288
ORDER BY f.position ASC
0.852 ms 7 Yes /classes/Product.php:5993
556
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 599) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.852 ms 2 Yes /classes/SpecificPrice.php:576
251
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 299
ORDER BY f.position ASC
0.846 ms 7 Yes /classes/Product.php:5993
433
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 2765) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.843 ms 3 Yes /classes/SpecificPrice.php:576
206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 295 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.838 ms 0 /classes/Cart.php:1410
207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 295
ORDER BY f.position ASC
0.838 ms 7 Yes /classes/Product.php:5993
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 304
ORDER BY f.position ASC
0.838 ms 7 Yes /classes/Product.php:5993
489
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6292) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.837 ms 3 Yes /classes/SpecificPrice.php:576
59
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`, cl.`link_rewrite`, category_shop.`id_shop`
FROM `mangayo_category` c
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE `id_lang` = 1
AND c.`id_parent` = 2
AND `active` = 1
GROUP BY c.`id_category`
ORDER BY category_shop.`position` ASC
0.837 ms 15 Yes Yes /classes/Category.php:1148
467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4911) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.835 ms 3 Yes /classes/SpecificPrice.php:576
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 294
ORDER BY f.position ASC
0.833 ms 7 Yes /classes/Product.php:5993
317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 305
ORDER BY f.position ASC
0.821 ms 7 Yes /classes/Product.php:5993
262
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 300
ORDER BY f.position ASC
0.821 ms 7 Yes /classes/Product.php:5993
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 289
ORDER BY f.position ASC
0.815 ms 7 Yes /classes/Product.php:5993
633
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6293) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.812 ms 3 Yes /classes/SpecificPrice.php:576
229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 297
ORDER BY f.position ASC
0.810 ms 7 Yes /classes/Product.php:5993
152
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 290
ORDER BY f.position ASC
0.808 ms 7 Yes /classes/Product.php:5993
410
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4129) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.807 ms 3 Yes /classes/SpecificPrice.php:576
611
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 606) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.803 ms 2 Yes /classes/SpecificPrice.php:576
751
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.803 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
119
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 287
ORDER BY f.position ASC
0.802 ms 7 Yes /classes/Product.php:5993
399
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5877) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.797 ms 3 Yes /classes/SpecificPrice.php:576
328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 306
ORDER BY f.position ASC
0.794 ms 7 Yes /classes/Product.php:5993
478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5694) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.791 ms 3 Yes /classes/SpecificPrice.php:576
97
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 285
ORDER BY f.position ASC
0.790 ms 7 Yes /classes/Product.php:5993
747
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.790 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 302
ORDER BY f.position ASC
0.789 ms 7 Yes /classes/Product.php:5993
578
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 602) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.788 ms 2 Yes /classes/SpecificPrice.php:576
273
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 301
ORDER BY f.position ASC
0.787 ms 7 Yes /classes/Product.php:5993
174
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 292
ORDER BY f.position ASC
0.786 ms 7 Yes /classes/Product.php:5993
762
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.783 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
39
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.783 ms 465 /classes/CartRule.php:357
511
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 595) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.783 ms 2 Yes /classes/SpecificPrice.php:576
753
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.782 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
185
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 293
ORDER BY f.position ASC
0.781 ms 7 Yes /classes/Product.php:5993
218
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 296
ORDER BY f.position ASC
0.780 ms 7 Yes /classes/Product.php:5993
240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 298
ORDER BY f.position ASC
0.780 ms 7 Yes /classes/Product.php:5993
163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 291
ORDER BY f.position ASC
0.779 ms 7 Yes /classes/Product.php:5993
748
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.779 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
42
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.779 ms 1 /classes/CartRule.php:418
339
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 307
ORDER BY f.position ASC
0.777 ms 7 Yes /classes/Product.php:5993
545
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 597) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.771 ms 2 Yes /classes/SpecificPrice.php:576
589
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 604) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.771 ms 2 Yes /classes/SpecificPrice.php:576
644
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7797) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.770 ms 3 Yes /classes/SpecificPrice.php:576
655
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8527) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.770 ms 3 Yes /classes/SpecificPrice.php:576
622
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4997) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.768 ms 2 Yes /classes/SpecificPrice.php:576
295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 303
ORDER BY f.position ASC
0.767 ms 7 Yes /classes/Product.php:5993
768
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.765 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
445
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 405) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.763 ms 2 Yes /classes/SpecificPrice.php:576
600
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6533) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.763 ms 3 Yes /classes/SpecificPrice.php:576
331
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 307) AND (b.`id_shop` = 1) LIMIT 1
0.762 ms 1 /src/Adapter/EntityMapper.php:71
422
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3501) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.760 ms 3 Yes /classes/SpecificPrice.php:576
265
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 301) AND (b.`id_shop` = 1) LIMIT 1
0.758 ms 1 /src/Adapter/EntityMapper.php:71
243
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 299) AND (b.`id_shop` = 1) LIMIT 1
0.758 ms 1 /src/Adapter/EntityMapper.php:71
69
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 284) AND (b.`id_shop` = 1) LIMIT 1
0.757 ms 1 /src/Adapter/EntityMapper.php:71
763
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.755 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
419
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3501) AND (b.`id_shop` = 1) LIMIT 1
0.754 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 600) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.753 ms 2 Yes /classes/SpecificPrice.php:576
309
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 305) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 292) AND (b.`id_shop` = 1) LIMIT 1
0.750 ms 1 /src/Adapter/EntityMapper.php:71
754
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.750 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
22
SELECT SQL_NO_CACHE value FROM `mangayo_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.749 ms 1 /classes/shop/Shop.php:1183
232
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 298) AND (b.`id_shop` = 1) LIMIT 1
0.748 ms 1 /src/Adapter/EntityMapper.php:71
287
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 303) AND (b.`id_shop` = 1) LIMIT 1
0.744 ms 1 /src/Adapter/EntityMapper.php:71
111
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 287) AND (b.`id_shop` = 1) LIMIT 1
0.743 ms 1 /src/Adapter/EntityMapper.php:71
766
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.743 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
188
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 294) AND (b.`id_shop` = 1) LIMIT 1
0.742 ms 1 /src/Adapter/EntityMapper.php:71
254
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 300) AND (b.`id_shop` = 1) LIMIT 1
0.742 ms 1 /src/Adapter/EntityMapper.php:71
298
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 304) AND (b.`id_shop` = 1) LIMIT 1
0.741 ms 1 /src/Adapter/EntityMapper.php:71
387
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
0.740 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
276
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 302) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
122
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 288) AND (b.`id_shop` = 1) LIMIT 1
0.739 ms 1 /src/Adapter/EntityMapper.php:71
133
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 289) AND (b.`id_shop` = 1) LIMIT 1
0.738 ms 1 /src/Adapter/EntityMapper.php:71
144
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 290) AND (b.`id_shop` = 1) LIMIT 1
0.738 ms 1 /src/Adapter/EntityMapper.php:71
199
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 295) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
268
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 301)
0.734 ms 1 /classes/Product.php:3857
89
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 285) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
155
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 291) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
320
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 306) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
177
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 293) AND (b.`id_shop` = 1) LIMIT 1
0.732 ms 1 /src/Adapter/EntityMapper.php:71
746
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.728 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
41
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.725 ms 465 /classes/CartRule.php:357
841
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9260) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.724 ms 1 Yes Yes /classes/Product.php:4504
236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 298 AND id_shop=1 LIMIT 1
0.722 ms 1 /classes/Product.php:6848
522
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4131) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.711 ms 3 Yes /classes/SpecificPrice.php:576
769
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.711 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
210
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 296) AND (b.`id_shop` = 1) LIMIT 1
0.708 ms 1 /src/Adapter/EntityMapper.php:71
889
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7920) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.698 ms 1 Yes Yes /classes/Product.php:4504
761
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.696 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
35
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 90) AND (b.`id_shop` = 1) LIMIT 1
0.694 ms 1 /src/Adapter/EntityMapper.php:71
408
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4129) AND (b.`id_shop` = 1) LIMIT 1
0.691 ms 1 /src/Adapter/EntityMapper.php:71
500
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7920) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.689 ms 3 Yes /classes/SpecificPrice.php:576
389
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
0.685 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
456
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 9260) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.684 ms 3 Yes /classes/SpecificPrice.php:576
561
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 599 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 599 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.682 ms 0 /classes/Cart.php:1410
377
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12211) LIMIT 1
0.681 ms 1 /src/Adapter/EntityMapper.php:71
750
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.681 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
660
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8527 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8527 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.674 ms 0 /classes/Cart.php:1410
344
SELECT SQL_NO_CACHE c.id_category, cl.name, cl.link_rewrite FROM mangayo_category c LEFT JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN mangayo_category_lang cl ON (cl.id_category = c.id_category AND cl.id_shop = 1 )WHERE c.nleft <= 11 AND c.nright >= 28 AND c.nleft >= 2 AND c.nright <= 173 AND cl.id_lang = 1 AND c.level_depth > 1 ORDER BY c.level_depth ASC
0.673 ms 6 Yes /modules/facebookproductad/lib/moduleTools.php:526
765
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.668 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
1104
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 23 AND `id_shop` = 1
0.656 ms 1 /src/Adapter/EntityMapper.php:79
534
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 596) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.656 ms 2 Yes /classes/SpecificPrice.php:576
925
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (596) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.655 ms 1 Yes Yes /classes/Product.php:4504
853
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4911) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.654 ms 1 Yes Yes /classes/Product.php:4504
913
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4131) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.653 ms 1 Yes Yes /classes/Product.php:4504
391
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.652 ms 87 Yes /classes/Category.php:721
793
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4129) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4504
877
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6292) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4504
901
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (595) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.652 ms 1 Yes Yes /classes/Product.php:4504
997
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6533) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.651 ms 1 Yes Yes /classes/Product.php:4504
817
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2765) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.651 ms 1 Yes Yes /classes/Product.php:4504
415
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4129 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4129 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.650 ms 0 /classes/Cart.php:1410
34
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 88) AND (b.`id_shop` = 1) LIMIT 1
0.647 ms 1 /src/Adapter/EntityMapper.php:71
1045
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7797) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.646 ms 1 Yes Yes /classes/Product.php:4504
829
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (405) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.644 ms 1 Yes Yes /classes/Product.php:4504
1057
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8527) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.641 ms 1 Yes Yes /classes/Product.php:4504
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 295
AND image_shop.`cover` = 1 LIMIT 1
0.640 ms 1 /classes/Product.php:3570
865
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5694) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.639 ms 1 Yes Yes /classes/Product.php:4504
1009
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (606) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.639 ms 1 Yes Yes /classes/Product.php:4504
1033
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6293) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.637 ms 1 Yes Yes /classes/Product.php:4504
17
SELECT SQL_NO_CACHE name, alias FROM `mangayo_hook_alias`
0.637 ms 88 /classes/Hook.php:339
949
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (599) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.631 ms 1 Yes Yes /classes/Product.php:4504
781
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5877) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.630 ms 1 Yes Yes /classes/Product.php:4504
805
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3501) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.628 ms 1 Yes Yes /classes/Product.php:4504
450
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 405 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 405 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.626 ms 0 /classes/Cart.php:1410
937
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (597) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.621 ms 1 Yes Yes /classes/Product.php:4504
495
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6292
ORDER BY f.position ASC
0.617 ms 7 Yes /classes/Product.php:5993
631
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6293) AND (b.`id_shop` = 1) LIMIT 1
0.617 ms 1 /src/Adapter/EntityMapper.php:71
1110
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php'
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme"
0.617 ms 1 /classes/Smarty/SmartyCustom.php:184
973
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (602) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.615 ms 1 Yes Yes /classes/Product.php:4504
985
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (604) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.614 ms 1 Yes Yes /classes/Product.php:4504
52
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a0
LEFT JOIN `mangayo_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 11) AND (a0.`nright` > 28) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.612 ms 6 /classes/PrestaShopCollection.php:383
961
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (600) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4504
1021
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4997) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.612 ms 1 Yes Yes /classes/Product.php:4504
461
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9260 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.611 ms 0 /classes/Cart.php:1410
442
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 405) AND (b.`id_shop` = 1) LIMIT 1
0.610 ms 1 /src/Adapter/EntityMapper.php:71
1114
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.606 ms 1 /classes/Smarty/SmartyCustom.php:265
1106
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php'
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme"
0.606 ms 1 /classes/Smarty/SmartyCustom.php:184
438
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2765 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2765 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.604 ms 0 /classes/Cart.php:1410
587
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 604) AND (b.`id_shop` = 1) LIMIT 1
0.604 ms 1 /src/Adapter/EntityMapper.php:71
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 304)
0.602 ms 1 /classes/Product.php:3857
404
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5877 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5877 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.601 ms 0 /classes/Cart.php:1410
550
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 597 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 597 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.601 ms 0 /classes/Cart.php:1410
483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5694 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5694 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.600 ms 0 /classes/Cart.php:1410
431
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2765) AND (b.`id_shop` = 1) LIMIT 1
0.599 ms 1 /src/Adapter/EntityMapper.php:71
572
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 600 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 600 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.599 ms 0 /classes/Cart.php:1410
661
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8527
ORDER BY f.position ASC
0.599 ms 7 Yes /classes/Product.php:5993
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 289)
0.597 ms 1 /classes/Product.php:3857
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 294)
0.597 ms 1 /classes/Product.php:3857
609
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 606) AND (b.`id_shop` = 1) LIMIT 1
0.595 ms 1 /src/Adapter/EntityMapper.php:71
540
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 596
ORDER BY f.position ASC
0.594 ms 7 Yes /classes/Product.php:5993
76
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 284)
0.593 ms 1 /classes/Product.php:3857
103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 286)
0.592 ms 1 /classes/Product.php:3857
494
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6292 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6292 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.592 ms 0 /classes/Cart.php:1410
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `mangayo_hook_alias`
0.588 ms 88 /classes/Hook.php:287
263
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 301
AND image_shop.`cover` = 1 LIMIT 1
0.587 ms 1 /classes/Product.php:3570
551
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 597
ORDER BY f.position ASC
0.587 ms 7 Yes /classes/Product.php:5993
1079
SELECT SQL_NO_CACHE lb.`id_link_block`
FROM mangayo_link_block lb
INNER JOIN mangayo_link_block_shop lbs ON lbs.`id_link_block` = lb.`id_link_block`
WHERE lb. `id_hook` = 35 AND lbs.`id_shop` = 1
ORDER by lbs.`position`
0.587 ms 4 Yes /modules/ps_linklist/src/LegacyLinkBlockRepository.php:87
323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 306)
0.585 ms 1 /classes/Product.php:3857
208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 296
AND image_shop.`cover` = 1 LIMIT 1
0.583 ms 1 /classes/Product.php:3570
509
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 595) AND (b.`id_shop` = 1) LIMIT 1
0.583 ms 1 /src/Adapter/EntityMapper.php:71
235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 298)
0.582 ms 1 /classes/Product.php:3857
605
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6533 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6533 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.581 ms 0 /classes/Cart.php:1410
915
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4131)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.581 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 295)
0.580 ms 1 /classes/Product.php:3857
472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4911 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4911 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.580 ms 0 /classes/Cart.php:1410
484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5694
ORDER BY f.position ASC
0.579 ms 7 Yes /classes/Product.php:5993
1100
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 11 AND `id_shop` = 1
0.579 ms 1 /src/Adapter/EntityMapper.php:79
257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 300)
0.578 ms 1 /classes/Product.php:3857
224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 297)
0.577 ms 1 /classes/Product.php:3857
334
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 307)
0.577 ms 1 /classes/Product.php:3857
397
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5877) AND (b.`id_shop` = 1) LIMIT 1
0.577 ms 1 /src/Adapter/EntityMapper.php:71
487
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6292) AND (b.`id_shop` = 1) LIMIT 1
0.577 ms 1 /src/Adapter/EntityMapper.php:71
783
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5877)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.576 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
649
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7797 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7797 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.575 ms 0 /classes/Cart.php:1410
627
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4997 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4997 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.574 ms 0 /classes/Cart.php:1410
19
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.573 ms 1 /src/Adapter/EntityMapper.php:71
473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4911
ORDER BY f.position ASC
0.573 ms 7 Yes /classes/Product.php:5993
465
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4911) AND (b.`id_shop` = 1) LIMIT 1
0.572 ms 1 /src/Adapter/EntityMapper.php:71
158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 291)
0.571 ms 1 /classes/Product.php:3857
498
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7920) AND (b.`id_shop` = 1) LIMIT 1
0.571 ms 1 /src/Adapter/EntityMapper.php:71
531
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 596) AND (b.`id_shop` = 1) LIMIT 1
0.571 ms 1 /src/Adapter/EntityMapper.php:71
381
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM mangayo_layered_category
WHERE controller = 'category'
AND id_category = 11
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.570 ms 6 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
543
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 597) AND (b.`id_shop` = 1) LIMIT 1
0.568 ms 1 /src/Adapter/EntityMapper.php:71
180
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 293)
0.567 ms 1 /classes/Product.php:3857
1130
INSERT INTO `mangayo_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('7334427', '', 'mangayo.it/11-manga?page=3&q=Genere-Gang+Giovanili-Harem-Raccolta-Drammatico', '', '2024-06-28 13:07:21')
0.567 ms 1 /classes/ObjectModel.php:622
756
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php'
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
0.565 ms 1 /classes/Smarty/SmartyCustom.php:184
427
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3501 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3501 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.564 ms 0 /classes/Cart.php:1410
745
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
0.564 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
454
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9260) AND (b.`id_shop` = 1) LIMIT 1
0.564 ms 1 /src/Adapter/EntityMapper.php:71
520
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4131) AND (b.`id_shop` = 1) LIMIT 1
0.564 ms 1 /src/Adapter/EntityMapper.php:71
594
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 604 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 604 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.564 ms 0 /classes/Cart.php:1410
114
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 287)
0.563 ms 1 /classes/Product.php:3857
279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 302)
0.563 ms 1 /classes/Product.php:3857
312
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 305)
0.563 ms 1 /classes/Product.php:3857
1117
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php'
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme"
0.562 ms 1 /classes/Smarty/SmartyCustom.php:184
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM mangayo_shop_group gs
LEFT JOIN mangayo_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN mangayo_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.561 ms 1 Yes /classes/shop/Shop.php:715
92
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 285)
0.561 ms 1 /classes/Product.php:3857
505
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7920 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7920 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.561 ms 0 /classes/Cart.php:1410
527
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4131 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4131 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.561 ms 0 /classes/Cart.php:1410
598
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6533) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
476
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5694) AND (b.`id_shop` = 1) LIMIT 1
0.558 ms 1 /src/Adapter/EntityMapper.php:71
891
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7920)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.558 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 290)
0.557 ms 1 /classes/Product.php:3857
169
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 292)
0.557 ms 1 /classes/Product.php:3857
927
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 596)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.556 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1090
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 1 AND `id_shop` = 1
0.556 ms 1 /src/Adapter/EntityMapper.php:79
416
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4129
ORDER BY f.position ASC
0.555 ms 14 Yes /classes/Product.php:5993
732
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php'
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme"
0.555 ms 1 /classes/Smarty/SmartyCustom.php:184
1132
UPDATE `mangayo_page_viewed`
SET `counter` = `counter` + 1
WHERE `id_date_range` = 9307
AND `id_page` = 48
AND `id_shop` = 1
0.554 ms 1 /classes/Page.php:131
595
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 604
ORDER BY f.position ASC
0.553 ms 7 Yes /classes/Product.php:5993
638
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6293 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.552 ms 0 /classes/Cart.php:1410
795
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4129)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.552 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
153
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 291
AND image_shop.`cover` = 1 LIMIT 1
0.551 ms 1 /classes/Product.php:3570
516
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 595 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 595 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.551 ms 0 /classes/Cart.php:1410
252
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 300
AND image_shop.`cover` = 1 LIMIT 1
0.550 ms 1 /classes/Product.php:3570
451
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 405
ORDER BY f.position ASC
0.550 ms 7 Yes /classes/Product.php:5993
576
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 602) AND (b.`id_shop` = 1) LIMIT 1
0.550 ms 1 /src/Adapter/EntityMapper.php:71
1124
INSERT INTO `mangayo_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
0.550 ms 1 /classes/ObjectModel.php:622
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM mangayo_shop_url su
LEFT JOIN mangayo_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'mangayo.it' OR su.domain_ssl = 'mangayo.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.549 ms 1 Yes /classes/shop/Shop.php:1364
855
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4911)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.549 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
554
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 599) AND (b.`id_shop` = 1) LIMIT 1
0.548 ms 1 /src/Adapter/EntityMapper.php:71
1128
INSERT INTO `mangayo_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('7563407', '48', '60157778', '', '1', '1', '2024-06-28 13:07:21')
0.548 ms 1 /classes/ObjectModel.php:622
131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 289
AND image_shop.`cover` = 1 LIMIT 1
0.546 ms 1 /classes/Product.php:3570
653
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8527) AND (b.`id_shop` = 1) LIMIT 1
0.546 ms 1 /src/Adapter/EntityMapper.php:71
80
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 211)
AND ('00133' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '00133')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.545 ms 0 /classes/tax/TaxRulesTaxManager.php:109
539
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 596 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 596 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.545 ms 0 /classes/Cart.php:1410
616
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 606 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 606 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.545 ms 0 /classes/Cart.php:1410
1011
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 606)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.545 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
565
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 600) AND (b.`id_shop` = 1) LIMIT 1
0.544 ms 1 /src/Adapter/EntityMapper.php:71
916
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.542 ms 1 /modules/an_wishlist/classes/an_wish.php:76
886
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6292
ORDER BY `position`
0.542 ms 1 Yes /classes/Product.php:3545
1035
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6293)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.542 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
642
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7797) AND (b.`id_shop` = 1) LIMIT 1
0.541 ms 1 /src/Adapter/EntityMapper.php:71
213
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 296)
0.541 ms 1 /classes/Product.php:3857
573
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 600
ORDER BY f.position ASC
0.541 ms 7 Yes /classes/Product.php:5993
810
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3501) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.541 ms 1 /classes/stock/StockAvailable.php:778
1125
SELECT SQL_NO_CACHE `id_guest`
FROM `mangayo_connections`
WHERE `id_guest` = 7563407
AND `date_add` > '2024-06-28 12:37:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.541 ms 1 Yes /classes/Connection.php:168
583
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 602 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 602 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.540 ms 0 /classes/Cart.php:1410
584
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 602
ORDER BY f.position ASC
0.540 ms 7 Yes /classes/Product.php:5993
903
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 595)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.540 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1006
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6533
ORDER BY `position`
0.540 ms 1 Yes /classes/Product.php:3545
879
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6292)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.539 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 288)
0.539 ms 1 /classes/Product.php:3857
620
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4997) AND (b.`id_shop` = 1) LIMIT 1
0.538 ms 1 /src/Adapter/EntityMapper.php:71
910
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 595
ORDER BY `position`
0.538 ms 1 Yes /classes/Product.php:3545
1047
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7797)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.538 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 303)
0.536 ms 1 /classes/Product.php:3857
297
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.535 ms 1 /classes/Product.php:5639
329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 307
AND image_shop.`cover` = 1 LIMIT 1
0.535 ms 1 /classes/Product.php:3570
951
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 599)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.535 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
999
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6533)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.534 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
963
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 600)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.534 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
38
SELECT SQL_NO_CACHE 1 FROM mangayo_cart_product cp INNER JOIN mangayo_product p
ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.533 ms 1 /classes/Cart.php:4192
987
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 604)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.533 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 305
AND image_shop.`cover` = 1 LIMIT 1
0.533 ms 1 /classes/Product.php:3570
838
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 405
ORDER BY `position`
0.532 ms 1 Yes /classes/Product.php:3545
826
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2765
ORDER BY `position`
0.531 ms 1 Yes /classes/Product.php:3545
24
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.531 ms 1 /src/Adapter/EntityMapper.php:71
506
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7920
ORDER BY f.position ASC
0.531 ms 7 Yes /classes/Product.php:5993
517
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 595
ORDER BY f.position ASC
0.531 ms 7 Yes /classes/Product.php:5993
1018
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 606
ORDER BY `position`
0.531 ms 1 Yes /classes/Product.php:3545
807
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3501)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.529 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
831
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 405)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.529 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1122
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_widgets` sw
LEFT JOIN `mangayo_an_trust_badges_widgets_lang` sl 
ON (sw.`id_widget` = sl.`id_widget`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1 
AND sw.`hook`="displayCopyrightContainer"
0.529 ms 2 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php:86
285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 303
AND image_shop.`cover` = 1 LIMIT 1
0.528 ms 1 /classes/Product.php:3570
405
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5877
ORDER BY f.position ASC
0.528 ms 14 Yes /classes/Product.php:5993
639
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6293
ORDER BY f.position ASC
0.528 ms 7 Yes /classes/Product.php:5993
843
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 9260)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.528 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1059
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8527)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.528 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 304
AND image_shop.`cover` = 1 LIMIT 1
0.527 ms 1 /classes/Product.php:3570
975
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 602)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.527 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
98
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 286
AND image_shop.`cover` = 1 LIMIT 1
0.527 ms 1 /classes/Product.php:3570
958
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 599
ORDER BY `position`
0.527 ms 1 Yes /classes/Product.php:3545
939
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 597)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.526 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
819
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 2765)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.525 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 292
AND image_shop.`cover` = 1 LIMIT 1
0.524 ms 1 /classes/Product.php:3570
1098
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 10 AND `id_shop` = 1
0.524 ms 1 /src/Adapter/EntityMapper.php:79
606
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6533
ORDER BY f.position ASC
0.524 ms 7 Yes /classes/Product.php:5993
867
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5694)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.523 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
66
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 284
AND image_shop.`cover` = 1 LIMIT 1
0.522 ms 1 /classes/Product.php:3570
318
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 306
AND image_shop.`cover` = 1 LIMIT 1
0.522 ms 1 /classes/Product.php:3570
936
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 596
0.522 ms 1 /classes/Product.php:2902
948
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 597
0.522 ms 1 /classes/Product.php:2902
241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 299
AND image_shop.`cover` = 1 LIMIT 1
0.519 ms 1 /classes/Product.php:3570
462
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9260
ORDER BY f.position ASC
0.519 ms 21 Yes /classes/Product.php:5993
760
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
0.518 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 298
AND image_shop.`cover` = 1 LIMIT 1
0.518 ms 1 /classes/Product.php:3570
1023
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4997)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.518 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
175
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 293
AND image_shop.`cover` = 1 LIMIT 1
0.517 ms 1 /classes/Product.php:3570
562
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 599
ORDER BY f.position ASC
0.517 ms 7 Yes /classes/Product.php:5993
1127
SELECT SQL_NO_CACHE `id_page`
FROM `mangayo_page`
WHERE `id_page_type` = 7 AND `id_object` = 11 LIMIT 1
0.516 ms 1 /classes/Page.php:83
982
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 602
ORDER BY `position`
0.515 ms 1 Yes /classes/Product.php:3545
439
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2765
ORDER BY f.position ASC
0.514 ms 14 Yes /classes/Product.php:5993
428
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3501
ORDER BY f.position ASC
0.513 ms 14 Yes /classes/Product.php:5993
862
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4911
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
850
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9260
ORDER BY `position`
0.512 ms 1 Yes /classes/Product.php:3545
186
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 294
AND image_shop.`cover` = 1 LIMIT 1
0.511 ms 1 /classes/Product.php:3570
86
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.509 ms 0 /classes/tax/TaxRulesTaxManager.php:109
87
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 285
AND image_shop.`cover` = 1 LIMIT 1
0.509 ms 1 /classes/Product.php:3570
1030
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4997
ORDER BY `position`
0.508 ms 1 Yes /classes/Product.php:3545
601
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6533)
0.506 ms 1 /classes/Product.php:3857
120
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 288
AND image_shop.`cover` = 1 LIMIT 1
0.506 ms 1 /classes/Product.php:3570
790
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5877
ORDER BY `position`
0.506 ms 1 Yes /classes/Product.php:3545
628
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4997
ORDER BY f.position ASC
0.505 ms 7 Yes /classes/Product.php:5993
802
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4129
ORDER BY `position`
0.505 ms 1 Yes /classes/Product.php:3545
219
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 297
AND image_shop.`cover` = 1 LIMIT 1
0.504 ms 1 /classes/Product.php:3570
1119
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 148 AND `id_shop` = 1 LIMIT 1
0.504 ms 1 /classes/module/Module.php:2109
699
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6533
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
528
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4131
ORDER BY f.position ASC
0.503 ms 14 Yes /classes/Product.php:5993
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 290
AND image_shop.`cover` = 1 LIMIT 1
0.502 ms 1 /classes/Product.php:3570
617
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 606
ORDER BY f.position ASC
0.502 ms 7 Yes /classes/Product.php:5993
814
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3501
ORDER BY `position`
0.501 ms 1 Yes /classes/Product.php:3545
994
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 604
ORDER BY `position`
0.501 ms 1 Yes /classes/Product.php:3545
1054
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7797
ORDER BY `position`
0.501 ms 1 Yes /classes/Product.php:3545
830
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 405
0.500 ms 3 /classes/Product.php:3423
274
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 302
AND image_shop.`cover` = 1 LIMIT 1
0.499 ms 1 /classes/Product.php:3570
946
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 597
ORDER BY `position`
0.499 ms 1 Yes /classes/Product.php:3545
1066
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8527
ORDER BY `position`
0.499 ms 1 Yes /classes/Product.php:3545
922
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4131
ORDER BY `position`
0.499 ms 1 Yes /classes/Product.php:3545
1123
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_icons` sw
WHERE sw.`active`=1
0.498 ms 40 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php:84
109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 287
AND image_shop.`cover` = 1 LIMIT 1
0.497 ms 1 /classes/Product.php:3570
378
SELECT SQL_NO_CACHE *
FROM `mangayo_product_lang`
WHERE `id_product` = 12211 AND `id_shop` = 1
0.496 ms 1 /src/Adapter/EntityMapper.php:79
541
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 597
AND image_shop.`cover` = 1 LIMIT 1
0.496 ms 1 /classes/Product.php:3570
650
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7797
ORDER BY f.position ASC
0.496 ms 7 Yes /classes/Product.php:5993
898
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7920
ORDER BY `position`
0.495 ms 1 Yes /classes/Product.php:3545
970
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 600
ORDER BY `position`
0.495 ms 1 Yes /classes/Product.php:3545
733
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.494 ms 1 /classes/module/Module.php:2636
934
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 596
ORDER BY `position`
0.494 ms 1 Yes /classes/Product.php:3545
1108
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme" LIMIT 1
0.494 ms 1 /classes/Smarty/SmartyCustom.php:216
88
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.492 ms 1 /classes/Product.php:5639
6
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.491 ms 1 /src/Adapter/EntityMapper.php:71
26
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.490 ms 1 /src/Adapter/EntityMapper.php:71
771
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php'
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
0.490 ms 1 /classes/Smarty/SmartyCustom.php:184
972
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 600
0.490 ms 1 /classes/Product.php:2902
874
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5694
ORDER BY `position`
0.487 ms 1 Yes /classes/Product.php:3545
214
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 296 AND id_shop=1 LIMIT 1
0.486 ms 1 /classes/Product.php:6848
1065
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8527 LIMIT 1
0.485 ms 1 /classes/Product.php:1106
957
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 599 LIMIT 1
0.482 ms 1 /classes/Product.php:1106
770
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.481 ms 1 /classes/Smarty/SmartyCustom.php:265
749
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
0.480 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
1129
INSERT IGNORE INTO `mangayo_connections_page` (`id_connections`, `id_page`, `time_start`) VALUES ('7334427', '48', '2024-06-28 13:07:21')
0.480 ms 1 /classes/Connection.php:122
1077
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.479 ms 1 /classes/Smarty/SmartyCustom.php:265
1042
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6293
ORDER BY `position`
0.478 ms 1 Yes /classes/Product.php:3545
1109
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('9b994322a10138ad46146161c46d70ed',"","charme", FROM_UNIXTIME(1719572841))
0.478 ms 1 /classes/Smarty/SmartyCustom.php:265
929
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 596 LIMIT 1
0.478 ms 100 /modules/an_wishlist/classes/an_wish_products.php:124
1099
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 11) LIMIT 1
0.473 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `mangayo_lang` l
JOIN mangayo_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.472 ms 1 /classes/Language.php:1216
918
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.472 ms 1 /classes/stock/StockAvailable.php:778
340
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) LIMIT 1
0.471 ms 1 /src/Adapter/EntityMapper.php:71
1062
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8527) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.471 ms 1 /classes/stock/StockAvailable.php:778
411
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4129)
0.470 ms 1 /classes/Product.php:3857
49
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.470 ms 1 /src/Adapter/EntityMapper.php:71
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 304 AND id_shop=1 LIMIT 1
0.469 ms 1 /classes/Product.php:6848
341
SELECT SQL_NO_CACHE *
FROM `mangayo_category_lang`
WHERE `id_category` = 11 AND `id_shop` = 1
0.469 ms 1 /src/Adapter/EntityMapper.php:79
701
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 606
ORDER BY `position`
0.467 ms 1 Yes /classes/Product.php:3545
434
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2765)
0.467 ms 1 /classes/Product.php:3857
264
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.464 ms 1 /classes/Product.php:5639
435
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 2765 AND id_shop=1 LIMIT 1
0.464 ms 1 /classes/Product.php:6848
479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5694)
0.464 ms 1 /classes/Product.php:3857
1086
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 16 AND `id_shop` = 1
0.464 ms 1 /src/Adapter/EntityMapper.php:79
590
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 604)
0.463 ms 1 /classes/Product.php:3857
1092
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 19 AND `id_shop` = 1
0.463 ms 1 /src/Adapter/EntityMapper.php:79
743
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.462 ms 1 /classes/Smarty/SmartyCustom.php:265
764
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
0.462 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.460 ms 1 /classes/stock/StockAvailable.php:453
1068
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8527
0.460 ms 1 /classes/Product.php:2902
45
SELECT SQL_NO_CACHE * FROM `mangayo_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.459 ms 18 Yes /classes/ImageType.php:109
1095
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 9) LIMIT 1
0.458 ms 1 /src/Adapter/EntityMapper.php:71
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM mangayo_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.457 ms 1 /classes/shop/ShopUrl.php:182
535
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 596)
0.457 ms 1 /classes/Product.php:3857
924
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4131
0.457 ms 1 /classes/Product.php:2902
490
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6292)
0.457 ms 1 /classes/Product.php:3857
685
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4131
ORDER BY `position`
0.456 ms 1 Yes /classes/Product.php:3545
612
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 606)
0.455 ms 1 /classes/Product.php:3857
1101
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 15) LIMIT 1
0.455 ms 1 /src/Adapter/EntityMapper.php:71
355
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.455 ms 0 /classes/module/Module.php:2109
579
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 602)
0.455 ms 1 /classes/Product.php:3857
705
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6293
ORDER BY `position`
0.455 ms 1 Yes /classes/Product.php:3545
1126
SELECT SQL_NO_CACHE id_page_type
FROM mangayo_page_type
WHERE name = 'category' LIMIT 1
0.454 ms 1 /classes/Page.php:104
658
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8527 AND `id_group` = 1 LIMIT 1
0.454 ms 0 /classes/GroupReduction.php:156
634
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6293)
0.453 ms 1 /classes/Product.php:3857
1085
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 16) LIMIT 1
0.453 ms 1 /src/Adapter/EntityMapper.php:71
1102
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 15 AND `id_shop` = 1
0.453 ms 1 /src/Adapter/EntityMapper.php:79
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 289) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.452 ms 1 /classes/stock/StockAvailable.php:453
485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6292
AND image_shop.`cover` = 1 LIMIT 1
0.452 ms 1 /classes/Product.php:3570
468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4911)
0.452 ms 1 /classes/Product.php:3857
77
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 284 AND id_shop=1 LIMIT 1
0.451 ms 1 /classes/Product.php:6848
691
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 599
ORDER BY `position`
0.450 ms 1 Yes /classes/Product.php:3545
71
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `id_product` != 0 LIMIT 1
0.449 ms 8769 /classes/SpecificPrice.php:297
400
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5877)
0.448 ms 1 /classes/Product.php:3857
742
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
0.447 ms 0 /classes/Smarty/SmartyCustom.php:216
172
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.447 ms 1 /classes/stock/StockAvailable.php:453
964
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.446 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1071
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_contactinfo" LIMIT 1
0.445 ms 1 /classes/module/Module.php:2636
956
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 599) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.444 ms 1 /classes/stock/StockAvailable.php:806
90
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.444 ms 1 /classes/SpecificPrice.php:259
501
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7920)
0.443 ms 1 /classes/Product.php:3857
888
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6292
0.443 ms 1 /classes/Product.php:2902
1103
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 23) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
266
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 301
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.442 ms 1 /classes/SpecificPrice.php:259
1029
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4997 LIMIT 1
0.442 ms 1 /classes/Product.php:1106
429
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2765
AND image_shop.`cover` = 1 LIMIT 1
0.441 ms 1 /classes/Product.php:3570
640
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7797
AND image_shop.`cover` = 1 LIMIT 1
0.440 ms 1 /classes/Product.php:3570
458
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 9260 AND id_shop=1 LIMIT 1
0.440 ms 1 /classes/Product.php:6848
731
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('4a4b03e34f9266c4e082efcc7a2e039e',"","charme", FROM_UNIXTIME(1719572841))
0.440 ms 1 /classes/Smarty/SmartyCustom.php:265
833
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 405 LIMIT 1
0.440 ms 128 /modules/an_wishlist/classes/an_wish_products.php:124
446
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 405)
0.439 ms 1 /classes/Product.php:3857
986
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 604
0.439 ms 2 /classes/Product.php:3423
681
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7920
ORDER BY `position`
0.438 ms 1 Yes /classes/Product.php:3545
249
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.438 ms 1 /classes/stock/StockAvailable.php:453
375
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "payplug" LIMIT 1
0.438 ms 1 /classes/module/Module.php:2636
730
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme" LIMIT 1
0.438 ms 0 /classes/Smarty/SmartyCustom.php:216
1093
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 8) LIMIT 1
0.438 ms 1 /src/Adapter/EntityMapper.php:71
662
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5877
ORDER BY `position`
0.437 ms 1 Yes /classes/Product.php:3545
981
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 602 LIMIT 1
0.437 ms 1 /classes/Product.php:1106
1105
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.437 ms 1 /classes/Smarty/SmartyCustom.php:265
1133
SELECT SQL_NO_CACHE data
FROM `mangayo_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.437 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM mangayo_shop s
LEFT JOIN mangayo_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.436 ms 1 /classes/shop/Shop.php:218
1063
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8527) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.436 ms 1 /classes/stock/StockAvailable.php:753
63
SELECT SQL_NO_CACHE * FROM `mangayo_image_type`
0.436 ms 18 /classes/ImageType.php:161
820
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.436 ms 1 /modules/an_wishlist/classes/an_wish.php:76
651
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8527
AND image_shop.`cover` = 1 LIMIT 1
0.435 ms 1 /classes/Product.php:3570
758
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.435 ms 1 /classes/Smarty/SmartyCustom.php:265
20
SELECT SQL_NO_CACHE * FROM `mangayo_currency` c ORDER BY `iso_code` ASC
0.435 ms 1 Yes /classes/Currency.php:709
1097
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 10) LIMIT 1
0.435 ms 1 /src/Adapter/EntityMapper.php:71
244
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.434 ms 1 /classes/SpecificPrice.php:259
842
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 9260
0.434 ms 3 /classes/Product.php:3423
868
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.434 ms 1 /modules/an_wishlist/classes/an_wish.php:76
813
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3501 LIMIT 1
0.434 ms 1 /classes/Product.php:1106
46
SELECT SQL_NO_CACHE format
FROM `mangayo_address_format`
WHERE `id_country` = 10 LIMIT 1
0.433 ms 1 /classes/AddressFormat.php:656
346
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 14 LIMIT 1
0.433 ms 1 /classes/Hook.php:244
940
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.431 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1037
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6293 LIMIT 1
0.431 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 291
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.431 ms 1 /classes/SpecificPrice.php:259
840
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 405
0.431 ms 1 /classes/Product.php:2902
804
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4129
0.430 ms 1 /classes/Product.php:2902
618
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4997
AND image_shop.`cover` = 1 LIMIT 1
0.430 ms 1 /classes/Product.php:3570
1048
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.430 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1118
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_copyright" LIMIT 1
0.429 ms 1 /classes/module/Module.php:2636
25
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.429 ms 1 /classes/Language.php:883
689
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 597
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
873
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5694 LIMIT 1
0.429 ms 1 /classes/Product.php:1106
29
SELECT SQL_NO_CACHE *
FROM `mangayo_group` a
LEFT JOIN `mangayo_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.428 ms 1 /src/Adapter/EntityMapper.php:71
965
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 600 LIMIT 1
0.428 ms 65 /modules/an_wishlist/classes/an_wish_products.php:124
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `mangayo_lang` l
LEFT JOIN `mangayo_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.428 ms 1 /classes/Language.php:1080
23
SELECT SQL_NO_CACHE c.id_currency
FROM `mangayo_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.428 ms 1 /classes/Currency.php:893
667
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3501
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
677
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5694
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
695
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 602
ORDER BY `position`
0.428 ms 1 Yes /classes/Product.php:3545
209
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.427 ms 1 /classes/Product.php:5639
216
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.427 ms 1 /classes/stock/StockAvailable.php:453
440
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 405
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
945
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 597 LIMIT 1
0.427 ms 1 /classes/Product.php:1106
1002
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.427 ms 1 /classes/stock/StockAvailable.php:778
1080
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 1) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
693
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 600
ORDER BY `position`
0.427 ms 1 Yes /classes/Product.php:3545
70
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE id_product = 0 LIMIT 1
0.426 ms 1 /classes/SpecificPrice.php:426
557
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 599)
0.426 ms 1 /classes/Product.php:3857
774
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
0.426 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
1013
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 606 LIMIT 1
0.426 ms 65 /modules/an_wishlist/classes/an_wish_products.php:124
1113
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme" LIMIT 1
0.426 ms 1 /classes/Smarty/SmartyCustom.php:216
36
SELECT SQL_NO_CACHE * FROM `mangayo_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.426 ms 1 /classes/module/Module.php:2018
645
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7797)
0.426 ms 1 /classes/Product.php:3857
512
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 595)
0.425 ms 1 /classes/Product.php:3857
880
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.425 ms 1 /modules/an_wishlist/classes/an_wish.php:76
954
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 599) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.425 ms 1 /classes/stock/StockAvailable.php:778
227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.425 ms 1 /classes/stock/StockAvailable.php:453
703
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4997
ORDER BY `position`
0.425 ms 1 Yes /classes/Product.php:3545
1000
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.424 ms 1 /modules/an_wishlist/classes/an_wish.php:76
60
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='compile' LIMIT 1
0.424 ms 1 /classes/Smarty/SmartyCustom.php:96
523
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4131)
0.424 ms 1 /classes/Product.php:3857
1044
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6293
0.423 ms 1 /classes/Product.php:2902
117
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.423 ms 1 /classes/stock/StockAvailable.php:453
942
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.423 ms 1 /classes/stock/StockAvailable.php:778
1025
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4997 LIMIT 1
0.423 ms 11 /modules/an_wishlist/classes/an_wish_products.php:124
3
SELECT SQL_NO_CACHE *
FROM `mangayo_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.422 ms 1 /src/Adapter/EntityMapper.php:71
112
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.422 ms 1 /classes/SpecificPrice.php:259
894
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7920) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.422 ms 1 /classes/stock/StockAvailable.php:778
324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 306 AND id_shop=1 LIMIT 1
0.421 ms 1 /classes/Product.php:6848
673
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9260
ORDER BY `position`
0.421 ms 1 Yes /classes/Product.php:3545
907
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 595) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.421 ms 1 /classes/stock/StockAvailable.php:753
909
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 595 LIMIT 1
0.421 ms 1 /classes/Product.php:1106
1036
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.421 ms 1 /modules/an_wishlist/classes/an_wish.php:76
457
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9260)
0.421 ms 1 /classes/Product.php:3857
326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.420 ms 1 /classes/stock/StockAvailable.php:453
844
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.420 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1024
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.420 ms 1 /modules/an_wishlist/classes/an_wish.php:76
170
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 292 AND id_shop=1 LIMIT 1
0.420 ms 1 /classes/Product.php:6848
310
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.420 ms 1 /classes/SpecificPrice.php:259
280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 302 AND id_shop=1 LIMIT 1
0.419 ms 1 /classes/Product.php:6848
574
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 602
AND image_shop.`cover` = 1 LIMIT 1
0.419 ms 1 /classes/Product.php:3570
1041
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6293 LIMIT 1
0.419 ms 1 /classes/Product.php:1106
211
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.419 ms 1 /classes/SpecificPrice.php:259
376
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 131 AND `id_shop` = 1 LIMIT 1
0.419 ms 1 /classes/module/Module.php:2109
496
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7920
AND image_shop.`cover` = 1 LIMIT 1
0.419 ms 1 /classes/Product.php:3570
697
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 604
ORDER BY `position`
0.419 ms 1 Yes /classes/Product.php:3545
952
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.419 ms 1 /modules/an_wishlist/classes/an_wish.php:76
203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 295 AND id_shop=1 LIMIT 1
0.418 ms 1 /classes/Product.php:6848
258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 300 AND id_shop=1 LIMIT 1
0.418 ms 1 /classes/Product.php:6848
342
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 11) LIMIT 1
0.418 ms 1 /classes/Category.php:1971
452
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9260
AND image_shop.`cover` = 1 LIMIT 1
0.418 ms 1 /classes/Product.php:3570
623
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4997)
0.418 ms 1 /classes/Product.php:3857
665
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4129
ORDER BY `position`
0.418 ms 1 Yes /classes/Product.php:3545
933
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 596 LIMIT 1
0.418 ms 1 /classes/Product.php:1106
67
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 11 LIMIT 1
0.417 ms 1 /classes/Category.php:1375
121
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.417 ms 1 /classes/Product.php:5639
205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.417 ms 1 /classes/stock/StockAvailable.php:453
885
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6292 LIMIT 1
0.417 ms 1 /classes/Product.php:1106
50
SELECT SQL_NO_CACHE *
FROM `mangayo_country_lang`
WHERE `id_country` = 10
0.416 ms 1 /src/Adapter/EntityMapper.php:79
281
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 302 AND `id_group` = 1 LIMIT 1
0.416 ms 0 /classes/GroupReduction.php:156
395
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5877
AND image_shop.`cover` = 1 LIMIT 1
0.416 ms 1 /classes/Product.php:3570
423
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3501)
0.416 ms 1 /classes/Product.php:3857
707
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7797
ORDER BY `position`
0.416 ms 1 Yes /classes/Product.php:3545
788
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5877) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.416 ms 1 /classes/stock/StockAvailable.php:806
779
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_productattributes" LIMIT 1
0.416 ms 1 /classes/module/Module.php:2636
149
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 290 AND `id_group` = 1 LIMIT 1
0.415 ms 0 /classes/GroupReduction.php:156
837
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 405 LIMIT 1
0.415 ms 1 /classes/Product.php:1106
1121
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 150 AND `id_shop` = 1 LIMIT 1
0.415 ms 1 /classes/module/Module.php:2109
930
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 596) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.415 ms 1 /classes/stock/StockAvailable.php:778
969
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 600 LIMIT 1
0.415 ms 1 /classes/Product.php:1106
1064
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8527) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.415 ms 1 /classes/stock/StockAvailable.php:806
897
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7920 LIMIT 1
0.414 ms 1 /classes/Product.php:1106
921
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4131 LIMIT 1
0.414 ms 1 /classes/Product.php:1106
671
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 405
ORDER BY `position`
0.413 ms 1 Yes /classes/Product.php:3545
1115
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.413 ms 1 /classes/Smarty/SmartyCustom.php:265
27
SELECT SQL_NO_CACHE *
FROM `mangayo_currency_lang`
WHERE `id_currency` = 1
0.412 ms 1 /src/Adapter/EntityMapper.php:79
72
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `from` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
0.412 ms 1 /classes/SpecificPrice.php:377
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 294 AND id_shop=1 LIMIT 1
0.412 ms 1 /classes/Product.php:6848
200
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.412 ms 1 /classes/SpecificPrice.php:259
231
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.412 ms 1 /classes/Product.php:5639
348
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_searchbar" LIMIT 1
0.412 ms 1 /classes/module/Module.php:2636
683
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 595
ORDER BY `position`
0.412 ms 1 Yes /classes/Product.php:3545
821
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 2765 LIMIT 1
0.412 ms 51 /modules/an_wishlist/classes/an_wish_products.php:124
8
SELECT SQL_NO_CACHE *
FROM `mangayo_lang` a
LEFT JOIN `mangayo_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.411 ms 1 /src/Adapter/EntityMapper.php:71
32
SELECT SQL_NO_CACHE ctg.`id_group`
FROM mangayo_category_group ctg
WHERE ctg.`id_category` = 11 AND ctg.`id_group` = 1 LIMIT 1
0.411 ms 1 /classes/Category.php:1751
187
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.411 ms 1 /classes/Product.php:5639
801
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4129 LIMIT 1
0.411 ms 1 /classes/Product.php:1106
1034
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6293
0.411 ms 3 /classes/Product.php:3423
669
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2765
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
928
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.410 ms 1 /modules/an_wishlist/classes/an_wish.php:76
993
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 604 LIMIT 1
0.410 ms 1 /classes/Product.php:1106
1053
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7797 LIMIT 1
0.410 ms 1 /classes/Product.php:1106
687
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 596
ORDER BY `position`
0.410 ms 1 Yes /classes/Product.php:3545
497
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.409 ms 1 /classes/Product.php:5639
54
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "productcomments" LIMIT 1
0.409 ms 1 /classes/module/Module.php:2636
463
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4911
AND image_shop.`cover` = 1 LIMIT 1
0.408 ms 1 /classes/Product.php:3570
794
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4129
0.408 ms 3 /classes/Product.php:3423
984
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 602
0.408 ms 1 /classes/Product.php:2902
28
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.408 ms 1 /classes/ObjectModel.php:1729
93
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 285 AND id_shop=1 LIMIT 1
0.408 ms 1 /classes/Product.php:6848
101
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.408 ms 1 /classes/SpecificPrice.php:259
679
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6292
ORDER BY `position`
0.408 ms 1 Yes /classes/Product.php:3545
926
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 596
0.408 ms 2 /classes/Product.php:3423
64
SELECT SQL_NO_CACHE id_order
FROM `mangayo_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.407 ms 1 /modules/facebookproductad/lib/dao/moduleDao.php:383
104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 286 AND id_shop=1 LIMIT 1
0.407 ms 1 /classes/Product.php:6848
519
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.407 ms 1 /classes/Product.php:5639
825
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 2765 LIMIT 1
0.407 ms 1 /classes/Product.php:1106
1005
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6533 LIMIT 1
0.407 ms 1 /classes/Product.php:1106
275
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.406 ms 1 /classes/Product.php:5639
709
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8527
ORDER BY `position`
0.406 ms 1 Yes /classes/Product.php:3545
729
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='template' LIMIT 1
0.406 ms 1 /classes/Smarty/SmartyCustom.php:143
828
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2765
0.406 ms 1 /classes/Product.php:2902
953
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 599 LIMIT 1
0.406 ms 68 /modules/an_wishlist/classes/an_wish_products.php:124
21
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.405 ms 1 /classes/Language.php:883
247
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 299 AND id_shop=1 LIMIT 1
0.405 ms 1 /classes/Product.php:6848
656
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8527)
0.405 ms 1 /classes/Product.php:3857
675
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4911
ORDER BY `position`
0.405 ms 1 Yes /classes/Product.php:3545
832
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.405 ms 1 /modules/an_wishlist/classes/an_wish.php:76
870
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.405 ms 1 /classes/stock/StockAvailable.php:778
988
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.405 ms 1 /modules/an_wishlist/classes/an_wish.php:76
914
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4131
0.405 ms 3 /classes/Product.php:3423
110
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.404 ms 1 /classes/Product.php:5639
1010
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 606
0.404 ms 3 /classes/Product.php:3423
1022
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4997
0.404 ms 2 /classes/Product.php:3423
950
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 599
0.403 ms 3 /classes/Product.php:3423
277
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.403 ms 1 /classes/SpecificPrice.php:259
568
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 600)
0.403 ms 1 /classes/Product.php:3857
787
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5877) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.403 ms 1 /classes/stock/StockAvailable.php:753
854
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4911
0.403 ms 3 /classes/Product.php:3423
784
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.402 ms 1 /modules/an_wishlist/classes/an_wish.php:76
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 294) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.402 ms 1 /classes/stock/StockAvailable.php:453
878
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6292
0.402 ms 3 /classes/Product.php:3423
417
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3501
AND image_shop.`cover` = 1 LIMIT 1
0.401 ms 1 /classes/Product.php:3570
466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4911
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.401 ms 1 /classes/SpecificPrice.php:259
818
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 2765
0.401 ms 3 /classes/Product.php:3423
1012
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.401 ms 1 /modules/an_wishlist/classes/an_wish.php:76
780
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.400 ms 1 /classes/module/Module.php:2109
861
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4911 LIMIT 1
0.400 ms 1 /classes/Product.php:1106
1112
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 14 AND `id_shop` = 1 LIMIT 1
0.400 ms 1 /classes/module/Module.php:2109
154
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.400 ms 1 /classes/Product.php:5639
1089
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 1) LIMIT 1
0.400 ms 1 /src/Adapter/EntityMapper.php:71
99
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.399 ms 1 /classes/Product.php:5639
269
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 301 AND id_shop=1 LIMIT 1
0.399 ms 1 /classes/Product.php:6848
864
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4911
0.399 ms 1 /classes/Product.php:2902
866
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5694
0.399 ms 3 /classes/Product.php:3423
904
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.399 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1008
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6533
0.399 ms 1 /classes/Product.php:2902
1091
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 19) LIMIT 1
0.399 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.399 ms 1 /classes/stock/StockAvailable.php:453
337
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.399 ms 1 /classes/stock/StockAvailable.php:453
330
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.398 ms 1 /classes/Product.php:5639
178
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.398 ms 1 /classes/SpecificPrice.php:259
1056
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7797
0.398 ms 1 /classes/Product.php:2902
808
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.397 ms 1 /modules/an_wishlist/classes/an_wish.php:76
161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 291) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.397 ms 1 /classes/stock/StockAvailable.php:453
248
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 299 AND `id_group` = 1 LIMIT 1
0.397 ms 0 /classes/GroupReduction.php:156
270
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 301 AND `id_group` = 1 LIMIT 1
0.397 ms 0 /classes/GroupReduction.php:156
332
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.397 ms 1 /classes/SpecificPrice.php:259
596
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6533
AND image_shop.`cover` = 1 LIMIT 1
0.397 ms 1 /classes/Product.php:3570
900
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7920
0.397 ms 1 /classes/Product.php:2902
83
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.396 ms 1 /classes/stock/StockAvailable.php:453
106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.396 ms 1 /classes/stock/StockAvailable.php:453
150
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 290) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.396 ms 1 /classes/stock/StockAvailable.php:453
253
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.396 ms 1 /classes/Product.php:5639
271
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 301) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.396 ms 1 /classes/stock/StockAvailable.php:453
288
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.396 ms 1 /classes/SpecificPrice.php:259
293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.396 ms 1 /classes/stock/StockAvailable.php:453
379
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 2 LIMIT 1
0.396 ms 0 /classes/Category.php:1375
849
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 9260 LIMIT 1
0.396 ms 1 /classes/Product.php:1106
881
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6292 LIMIT 1
0.396 ms 7 /modules/an_wishlist/classes/an_wish_products.php:124
1032
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4997
0.396 ms 1 /classes/Product.php:2902
1120
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_trust_badges" LIMIT 1
0.396 ms 1 /classes/module/Module.php:2636
917
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4131 LIMIT 1
0.396 ms 17 /modules/an_wishlist/classes/an_wish_products.php:124
48
SELECT SQL_NO_CACHE *
FROM `mangayo_state` a
WHERE (a.`id_state` = 211) LIMIT 1
0.395 ms 1 /src/Adapter/EntityMapper.php:71
204
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 295 AND `id_group` = 1 LIMIT 1
0.395 ms 0 /classes/GroupReduction.php:156
242
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.395 ms 1 /classes/Product.php:5639
796
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.395 ms 1 /modules/an_wishlist/classes/an_wish.php:76
992
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 604) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.395 ms 1 /classes/stock/StockAvailable.php:806
1076
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme" LIMIT 1
0.395 ms 0 /classes/Smarty/SmartyCustom.php:216
816
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3501
0.395 ms 1 /classes/Product.php:2902
989
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 604 LIMIT 1
0.395 ms 62 /modules/an_wishlist/classes/an_wish_products.php:124
95
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.394 ms 1 /classes/stock/StockAvailable.php:453
165
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.394 ms 1 /classes/Product.php:5639
325
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 306 AND `id_group` = 1 LIMIT 1
0.394 ms 0 /classes/GroupReduction.php:156
474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5694
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
563
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 600
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
912
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 595
0.394 ms 1 /classes/Product.php:2902
869
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5694 LIMIT 1
0.394 ms 7 /modules/an_wishlist/classes/an_wish_products.php:124
1060
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.394 ms 1 /modules/an_wishlist/classes/an_wish.php:76
143
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.393 ms 1 /classes/Product.php:5639
893
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7920 LIMIT 1
0.393 ms 10 /modules/an_wishlist/classes/an_wish_products.php:124
359
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.393 ms 0 /classes/module/Module.php:2109
546
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 597)
0.393 ms 1 /classes/Product.php:3857
713
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
0.393 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
789
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5877 LIMIT 1
0.393 ms 1 /classes/Product.php:1106
882
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.393 ms 1 /classes/stock/StockAvailable.php:778
996
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 604
0.393 ms 1 /classes/Product.php:2902
812
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3501) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.392 ms 1 /classes/stock/StockAvailable.php:806
835
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 405) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.392 ms 1 /classes/stock/StockAvailable.php:753
858
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4911) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.392 ms 1 /classes/stock/StockAvailable.php:778
189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 294
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.391 ms 1 /classes/SpecificPrice.php:259
315
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.391 ms 1 /classes/stock/StockAvailable.php:453
920
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.391 ms 1 /classes/stock/StockAvailable.php:806
962
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 600
0.391 ms 3 /classes/Product.php:3423
976
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.391 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1046
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7797
0.391 ms 3 /classes/Product.php:3423
1081
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 1
0.391 ms 1 /src/Adapter/EntityMapper.php:79
1111
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customeraccountlinks" LIMIT 1
0.391 ms 1 /classes/module/Module.php:2636
148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 290 AND id_shop=1 LIMIT 1
0.390 ms 1 /classes/Product.php:6848
123
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 288
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.390 ms 1 /classes/SpecificPrice.php:259
570
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 600 AND `id_group` = 1 LIMIT 1
0.390 ms 0 /classes/GroupReduction.php:156
786
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5877) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:778
128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 288) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.389 ms 1 /classes/stock/StockAvailable.php:453
30
SELECT SQL_NO_CACHE *
FROM `mangayo_group_lang`
WHERE `id_group` = 1
0.389 ms 1 /src/Adapter/EntityMapper.php:79
255
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 300
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.389 ms 1 /classes/SpecificPrice.php:259
319
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.389 ms 1 /classes/Product.php:5639
475
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.389 ms 1 /classes/Product.php:5639
481
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5694 AND `id_group` = 1 LIMIT 1
0.389 ms 0 /classes/GroupReduction.php:156
1015
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 606) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.389 ms 1 /classes/stock/StockAvailable.php:753
225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 297 AND id_shop=1 LIMIT 1
0.388 ms 1 /classes/Product.php:6848
321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.388 ms 1 /classes/SpecificPrice.php:259
757
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
0.388 ms 0 /classes/Smarty/SmartyCustom.php:216
1017
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 606 LIMIT 1
0.388 ms 1 /classes/Product.php:1106
115
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 287 AND id_shop=1 LIMIT 1
0.388 ms 1 /classes/Product.php:6848
126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 288 AND id_shop=1 LIMIT 1
0.388 ms 1 /classes/Product.php:6848
313
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 305 AND id_shop=1 LIMIT 1
0.388 ms 1 /classes/Product.php:6848
1069
SELECT SQL_NO_CACHE *
FROM `mangayo_image_type` a
WHERE (a.`id_image_type` = 14) LIMIT 1
0.388 ms 1 /src/Adapter/EntityMapper.php:71
366
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "jmsajaxsearch" LIMIT 1
0.387 ms 0 /classes/module/Module.php:2636
980
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 602) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:806
183
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:453
856
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.387 ms 1 /modules/an_wishlist/classes/an_wish.php:76
857
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4911 LIMIT 1
0.387 ms 7 /modules/an_wishlist/classes/an_wish_products.php:124
941
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 597 LIMIT 1
0.387 ms 61 /modules/an_wishlist/classes/an_wish_products.php:124
966
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 600) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:778
1082
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 6) LIMIT 1
0.387 ms 1 /src/Adapter/EntityMapper.php:71
94
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 285 AND `id_group` = 1 LIMIT 1
0.386 ms 0 /classes/GroupReduction.php:156
220
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.386 ms 1 /classes/Product.php:5639
286
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.386 ms 1 /classes/Product.php:5639
702
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 606
0.386 ms 1 /classes/Product.php:2902
198
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.385 ms 1 /classes/Product.php:5639
233
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.385 ms 1 /classes/SpecificPrice.php:259
1026
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.385 ms 1 /classes/stock/StockAvailable.php:778
1084
SELECT SQL_NO_CACHE *
FROM `mangayo_hook` a
WHERE (a.`id_hook` = 35) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
890
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7920
0.385 ms 3 /classes/Product.php:3423
51
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM mangayo_required_field
0.384 ms 1 /classes/ObjectModel.php:1592
61
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.384 ms 0 /classes/module/Module.php:2636
73
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `to` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
0.384 ms 1 /classes/SpecificPrice.php:381
343
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 2) LIMIT 1
0.384 ms 1 /classes/Category.php:1971
345
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.384 ms 0 /classes/module/Module.php:2636
1050
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.384 ms 1 /classes/stock/StockAvailable.php:778
127
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 288 AND `id_group` = 1 LIMIT 1
0.384 ms 0 /classes/GroupReduction.php:156
145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 290
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.384 ms 1 /classes/SpecificPrice.php:259
167
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 292
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.384 ms 1 /classes/SpecificPrice.php:259
380
SELECT SQL_NO_CACHE e.`id_product` as id
FROM `mangayo_product` e
WHERE (e.`id_product` = 12211) LIMIT 1
0.384 ms 1 /classes/ObjectModel.php:2029
44
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.383 ms 0 /classes/module/Module.php:2109
308
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.383 ms 1 /classes/Product.php:5639
349
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 25 AND `id_shop` = 1 LIMIT 1
0.383 ms 1 /classes/module/Module.php:2109
782
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5877
0.383 ms 3 /classes/Product.php:3423
834
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 405) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:778
979
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 602) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:753
132
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.382 ms 1 /classes/Product.php:5639
7
SELECT SQL_NO_CACHE *
FROM `mangayo_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.382 ms 1 /src/Adapter/EntityMapper.php:71
238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.382 ms 1 /classes/stock/StockAvailable.php:453
663
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5877
0.382 ms 1 /classes/Product.php:2902
737
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.382 ms 1 /modules/an_wishlist/classes/an_wish.php:76
772
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "sociallogin" LIMIT 1
0.382 ms 1 /classes/module/Module.php:2636
824
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 2765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.382 ms 1 /classes/stock/StockAvailable.php:806
1072
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 12 AND `id_shop` = 1 LIMIT 1
0.382 ms 1 /classes/module/Module.php:2109
1087
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) LIMIT 1
0.382 ms 1 /src/Adapter/EntityMapper.php:71
352
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "blocksearch_mod" LIMIT 1
0.381 ms 0 /classes/module/Module.php:2636
134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 289
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.381 ms 1 /classes/SpecificPrice.php:259
181
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 293 AND id_shop=1 LIMIT 1
0.381 ms 1 /classes/Product.php:6848
592
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 604 AND `id_group` = 1 LIMIT 1
0.381 ms 0 /classes/GroupReduction.php:156
1051
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.381 ms 1 /classes/stock/StockAvailable.php:753
53
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_homecategories" LIMIT 1
0.380 ms 0 /classes/module/Module.php:2636
335
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 307 AND id_shop=1 LIMIT 1
0.380 ms 1 /classes/Product.php:6848
860
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4911) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.380 ms 1 /classes/stock/StockAvailable.php:806
908
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 595) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.380 ms 1 /classes/stock/StockAvailable.php:806
569
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 600 AND id_shop=1 LIMIT 1
0.380 ms 1 /classes/Product.php:6848
193
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 294 AND `id_group` = 1 LIMIT 1
0.379 ms 0 /classes/GroupReduction.php:156
641
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.379 ms 1 /classes/Product.php:5639
1039
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.379 ms 1 /classes/stock/StockAvailable.php:753
1049
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7797 LIMIT 1
0.379 ms 2 /modules/an_wishlist/classes/an_wish_products.php:124
585
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 604
AND image_shop.`cover` = 1 LIMIT 1
0.379 ms 1 /classes/Product.php:3570
700
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6533
0.379 ms 1 /classes/Product.php:2902
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 289 AND id_shop=1 LIMIT 1
0.378 ms 1 /classes/Product.php:6848
138
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 289 AND `id_group` = 1 LIMIT 1
0.378 ms 0 /classes/GroupReduction.php:156
299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.378 ms 1 /classes/SpecificPrice.php:259
630
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.378 ms 1 /classes/Product.php:5639
735
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_wishlist" LIMIT 1
0.378 ms 1 /classes/module/Module.php:2636
775
SELECT SQL_NO_CACHE `iso_code`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.378 ms 1 /classes/Country.php:275
62
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "btfacebookchats" LIMIT 1
0.377 ms 0 /classes/module/Module.php:2636
74
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.377 ms 1 /classes/SpecificPrice.php:259
81
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 284 AND `id_group` = 1 LIMIT 1
0.377 ms 0 /classes/GroupReduction.php:156
82
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_group`
WHERE `id_group` = 1 LIMIT 1
0.377 ms 1 /classes/Group.php:154
291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 303 AND id_shop=1 LIMIT 1
0.377 ms 1 /classes/Product.php:6848
977
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 602 LIMIT 1
0.377 ms 66 /modules/an_wishlist/classes/an_wish_products.php:124
373
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.377 ms 0 /classes/module/Module.php:2109
845
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 9260 LIMIT 1
0.377 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
978
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 602) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.377 ms 1 /classes/stock/StockAvailable.php:778
1028
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.377 ms 1 /classes/stock/StockAvailable.php:806
176
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.376 ms 1 /classes/Product.php:5639
215
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 296 AND `id_group` = 1 LIMIT 1
0.376 ms 0 /classes/GroupReduction.php:156
603
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6533 AND `id_group` = 1 LIMIT 1
0.376 ms 0 /classes/GroupReduction.php:156
990
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 604) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.376 ms 1 /classes/stock/StockAvailable.php:778
260
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 300) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:453
741
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.375 ms 1 /classes/module/Module.php:2109
809
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3501 LIMIT 1
0.375 ms 44 /modules/an_wishlist/classes/an_wish_products.php:124
1004
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:806
460
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 9260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:453
350
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "leoproductsearch" LIMIT 1
0.374 ms 0 /classes/module/Module.php:2636
734
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 15 AND `id_shop` = 1 LIMIT 1
0.374 ms 1 /classes/module/Module.php:2109
836
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 405) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.374 ms 1 /classes/stock/StockAvailable.php:806
998
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6533
0.374 ms 3 /classes/Product.php:3423
1058
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8527
0.374 ms 3 /classes/Product.php:3423
968
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 600) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.374 ms 1 /classes/stock/StockAvailable.php:806
47
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.373 ms 1 /classes/Country.php:402
582
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 602) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:453
755
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.373 ms 1 /classes/Smarty/SmartyCustom.php:265
370
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tdsearchblock" LIMIT 1
0.373 ms 0 /classes/module/Module.php:2636
629
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6293
AND image_shop.`cover` = 1 LIMIT 1
0.373 ms 1 /classes/Product.php:3570
938
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 597
0.373 ms 2 /classes/Product.php:3423
944
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.373 ms 1 /classes/stock/StockAvailable.php:806
974
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 602
0.372 ms 3 /classes/Product.php:3423
453
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.372 ms 1 /classes/Product.php:5639
607
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 606
AND image_shop.`cover` = 1 LIMIT 1
0.372 ms 1 /classes/Product.php:3570
799
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:753
852
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9260
0.372 ms 1 /classes/Product.php:2902
871
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:753
876
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5694
0.372 ms 1 /classes/Product.php:2902
895
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7920) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:753
931
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 596) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.372 ms 1 /classes/stock/StockAvailable.php:753
1074
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_linklist" LIMIT 1
0.372 ms 1 /classes/module/Module.php:2636
303
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 304 AND `id_group` = 1 LIMIT 1
0.371 ms 0 /classes/GroupReduction.php:156
785
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5877 LIMIT 1
0.371 ms 24 /modules/an_wishlist/classes/an_wish_products.php:124
792
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5877
0.371 ms 1 /classes/Product.php:2902
892
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 11132205
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.371 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1001
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6533 LIMIT 1
0.371 ms 8 /modules/an_wishlist/classes/an_wish_products.php:124
1083
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 6
0.371 ms 1 /src/Adapter/EntityMapper.php:79
455
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 9260
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.370 ms 1 /classes/SpecificPrice.php:259
896
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7920) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.370 ms 1 /classes/stock/StockAvailable.php:806
943
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.370 ms 1 /classes/stock/StockAvailable.php:753
1040
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.370 ms 1 /classes/stock/StockAvailable.php:806
182
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 293 AND `id_group` = 1 LIMIT 1
0.369 ms 0 /classes/GroupReduction.php:156
797
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4129 LIMIT 1
0.369 ms 35 /modules/an_wishlist/classes/an_wish_products.php:124
846
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:778
1003
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:753
43
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.369 ms 0 /classes/module/Module.php:2636
171
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 292 AND `id_group` = 1 LIMIT 1
0.369 ms 0 /classes/GroupReduction.php:156
406
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4129
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
552
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 599
AND image_shop.`cover` = 1 LIMIT 1
0.369 ms 1 /classes/Product.php:3570
1020
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 606
0.369 ms 1 /classes/Product.php:2902
413
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4129 AND `id_group` = 1 LIMIT 1
0.368 ms 0 /classes/GroupReduction.php:156
502
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7920 AND id_shop=1 LIMIT 1
0.368 ms 1 /classes/Product.php:6848
806
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3501
0.368 ms 3 /classes/Product.php:3423
822
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.368 ms 1 /classes/stock/StockAvailable.php:778
955
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 599) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.368 ms 1 /classes/stock/StockAvailable.php:753
967
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 600) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.368 ms 1 /classes/stock/StockAvailable.php:753
354
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tmsearch" LIMIT 1
0.368 ms 0 /classes/module/Module.php:2636
739
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.368 ms 1 /classes/module/Module.php:2109
932
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 596) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.368 ms 1 /classes/stock/StockAvailable.php:806
1038
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.367 ms 1 /classes/stock/StockAvailable.php:778
448
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 405 AND `id_group` = 1 LIMIT 1
0.367 ms 0 /classes/GroupReduction.php:156
577
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 602
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.367 ms 1 /classes/SpecificPrice.php:259
740
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_logo" LIMIT 1
0.367 ms 1 /classes/module/Module.php:2636
1061
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8527 LIMIT 1
0.366 ms 3 /modules/an_wishlist/classes/an_wish_products.php:124
441
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.366 ms 1 /classes/Product.php:5639
759
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.366 ms 1 /classes/Smarty/SmartyCustom.php:265
800
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:806
884
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:806
529
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 596
AND image_shop.`cover` = 1 LIMIT 1
0.365 ms 1 /classes/Product.php:3570
1027
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.365 ms 1 /classes/stock/StockAvailable.php:753
314
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 305 AND `id_group` = 1 LIMIT 1
0.364 ms 0 /classes/GroupReduction.php:156
708
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7797
0.364 ms 1 /classes/Product.php:2902
847
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.364 ms 1 /classes/stock/StockAvailable.php:753
902
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 595
0.364 ms 3 /classes/Product.php:3423
116
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 287 AND `id_group` = 1 LIMIT 1
0.364 ms 0 /classes/GroupReduction.php:156
409
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4129
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.363 ms 1 /classes/SpecificPrice.php:259
68
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.363 ms 1 /classes/Product.php:5639
292
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 303 AND `id_group` = 1 LIMIT 1
0.363 ms 0 /classes/GroupReduction.php:156
610
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 606
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.363 ms 1 /classes/SpecificPrice.php:259
859
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4911) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.363 ms 1 /classes/stock/StockAvailable.php:753
1073
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.363 ms 1 /classes/Country.php:402
55
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 142 AND `id_shop` = 1 LIMIT 1
0.362 ms 0 /classes/module/Module.php:2109
491
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6292 AND id_shop=1 LIMIT 1
0.362 ms 1 /classes/Product.php:6848
823
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:753
518
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4131
AND image_shop.`cover` = 1 LIMIT 1
0.362 ms 1 /classes/Product.php:3570
798
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:778
9
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.361 ms 1 /classes/ObjectModel.php:1729
430
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.361 ms 1 /classes/Product.php:5639
432
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 2765
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.361 ms 1 /classes/SpecificPrice.php:259
1116
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.361 ms 1 /classes/Smarty/SmartyCustom.php:265
57
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_reviews" LIMIT 1
0.360 ms 0 /classes/module/Module.php:2636
160
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 291 AND `id_group` = 1 LIMIT 1
0.360 ms 0 /classes/GroupReduction.php:156
421
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3501
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.360 ms 1 /classes/SpecificPrice.php:259
443
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 7
AND `active` = 1 LIMIT 1
0.360 ms 1 /classes/Manufacturer.php:316
960
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 599
0.360 ms 1 /classes/Product.php:2902
31
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.359 ms 1 /classes/ObjectModel.php:1729
412
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4129 AND id_shop=1 LIMIT 1
0.359 ms 1 /classes/Product.php:6848
424
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3501 AND id_shop=1 LIMIT 1
0.359 ms 1 /classes/Product.php:6848
507
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 595
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
1075
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.359 ms 1 /classes/module/Module.php:2109
361
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.358 ms 0 /classes/module/Module.php:2109
492
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6292 AND `id_group` = 1 LIMIT 1
0.358 ms 0 /classes/GroupReduction.php:156
418
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.358 ms 1 /classes/Product.php:5639
226
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 297 AND `id_group` = 1 LIMIT 1
0.357 ms 0 /classes/GroupReduction.php:156
471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4911) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.357 ms 1 /classes/stock/StockAvailable.php:453
488
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6292
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.357 ms 1 /classes/SpecificPrice.php:259
773
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1
0.357 ms 1 /classes/module/Module.php:2109
1014
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 606) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.357 ms 1 /classes/stock/StockAvailable.php:778
811
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3501) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.356 ms 1 /classes/stock/StockAvailable.php:753
676
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4911
0.356 ms 1 /classes/Product.php:2902
736
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.356 ms 1 /classes/module/Module.php:2109
777
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 10 AND `id_shop` = 1 LIMIT 1
0.356 ms 1 /classes/module/Module.php:2109
356
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ttblocksearch" LIMIT 1
0.355 ms 0 /classes/module/Module.php:2636
365
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.355 ms 0 /classes/module/Module.php:2109
358
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labblocksearch" LIMIT 1
0.354 ms 0 /classes/module/Module.php:2636
364
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "stsearchbar" LIMIT 1
0.354 ms 0 /classes/module/Module.php:2636
426
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3501) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.354 ms 1 /classes/stock/StockAvailable.php:453
883
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.354 ms 1 /classes/stock/StockAvailable.php:753
362
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tvcmssearch" LIMIT 1
0.354 ms 0 /classes/module/Module.php:2636
367
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.353 ms 0 /classes/module/Module.php:2109
991
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 604) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.353 ms 1 /classes/stock/StockAvailable.php:753
159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 291 AND id_shop=1 LIMIT 1
0.353 ms 1 /classes/Product.php:6848
237
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 298 AND `id_group` = 1 LIMIT 1
0.352 ms 0 /classes/GroupReduction.php:156
608
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.352 ms 1 /classes/Product.php:5639
654
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8527
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.352 ms 1 /classes/SpecificPrice.php:259
368
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "bonsearch" LIMIT 1
0.351 ms 0 /classes/module/Module.php:2636
398
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5877
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.351 ms 1 /classes/SpecificPrice.php:259
449
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 405) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.351 ms 1 /classes/stock/StockAvailable.php:453
521
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4131
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.351 ms 1 /classes/SpecificPrice.php:259
559
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 599 AND `id_group` = 1 LIMIT 1
0.351 ms 0 /classes/GroupReduction.php:156
632
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.351 ms 1 /classes/SpecificPrice.php:259
664
SELECT SQL_NO_CACHE state FROM mangayo_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.351 ms 1 /classes/FeatureFlag.php:105
722
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `mangayo_currency` c
LEFT JOIN mangayo_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.351 ms 1 /classes/Currency.php:1136
744
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.351 ms 1 /classes/Smarty/SmartyCustom.php:265
776
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.351 ms 1 /classes/module/Module.php:2636
1016
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 606) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.351 ms 1 /classes/stock/StockAvailable.php:806
353
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.350 ms 0 /classes/module/Module.php:2109
357
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.350 ms 0 /classes/module/Module.php:2109
425
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3501 AND `id_group` = 1 LIMIT 1
0.349 ms 0 /classes/GroupReduction.php:156
480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5694 AND id_shop=1 LIMIT 1
0.349 ms 1 /classes/Product.php:6848
698
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 604
0.349 ms 1 /classes/Product.php:2902
848
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 9260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.349 ms 1 /classes/stock/StockAvailable.php:806
919
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.349 ms 1 /classes/stock/StockAvailable.php:753
420
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 5
AND `active` = 1 LIMIT 1
0.348 ms 1 /classes/Manufacturer.php:316
686
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4131
0.348 ms 1 /classes/Product.php:2902
1078
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572841))
0.348 ms 1 /classes/Smarty/SmartyCustom.php:265
444
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 405
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.348 ms 1 /classes/SpecificPrice.php:259
682
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7920
0.348 ms 1 /classes/Product.php:2902
872
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:806
555
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 599
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.347 ms 1 /classes/SpecificPrice.php:259
351
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.347 ms 0 /classes/module/Module.php:2109
738
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_shoppingcart" LIMIT 1
0.347 ms 1 /classes/module/Module.php:2636
564
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.346 ms 1 /classes/Product.php:5639
401
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5877 AND id_shop=1 LIMIT 1
0.346 ms 1 /classes/Product.php:6848
636
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6293 AND `id_group` = 1 LIMIT 1
0.346 ms 0 /classes/GroupReduction.php:156
363
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.345 ms 0 /classes/module/Module.php:2109
437
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 2765) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.345 ms 1 /classes/stock/StockAvailable.php:453
688
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 596
0.345 ms 1 /classes/Product.php:2902
566
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 600
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.343 ms 1 /classes/SpecificPrice.php:259
647
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7797 AND `id_group` = 1 LIMIT 1
0.343 ms 0 /classes/GroupReduction.php:156
684
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 595
0.343 ms 1 /classes/Product.php:2902
674
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9260
0.343 ms 1 /classes/Product.php:2902
1052
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.343 ms 1 /classes/stock/StockAvailable.php:806
624
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4997 AND id_shop=1 LIMIT 1
0.342 ms 1 /classes/Product.php:6848
536
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 596 AND id_shop=1 LIMIT 1
0.342 ms 1 /classes/Product.php:6848
678
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5694
0.342 ms 1 /classes/Product.php:2902
725
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "darkmode" LIMIT 1
0.341 ms 1 /classes/module/Module.php:2636
336
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 307 AND `id_group` = 1 LIMIT 1
0.341 ms 0 /classes/GroupReduction.php:156
371
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.341 ms 0 /classes/module/Module.php:2109
436
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 2765 AND `id_group` = 1 LIMIT 1
0.341 ms 0 /classes/GroupReduction.php:156
482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5694) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:453
532
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 6
AND `active` = 1 LIMIT 1
0.341 ms 1 /classes/Manufacturer.php:316
619
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.341 ms 1 /classes/Product.php:5639
694
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 600
0.341 ms 1 /classes/Product.php:2902
714
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 117 LIMIT 1
0.341 ms 1 /classes/Hook.php:244
680
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6292
0.340 ms 1 /classes/Product.php:2902
447
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 405 AND id_shop=1 LIMIT 1
0.340 ms 1 /classes/Product.php:6848
464
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.340 ms 1 /classes/Product.php:5639
537
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 596 AND `id_group` = 1 LIMIT 1
0.340 ms 0 /classes/GroupReduction.php:156
372
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "spsearchpro" LIMIT 1
0.339 ms 0 /classes/module/Module.php:2636
396
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.339 ms 1 /classes/Product.php:5639
530
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.339 ms 1 /classes/Product.php:5639
666
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4129
0.339 ms 1 /classes/Product.php:2902
360
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labsearch" LIMIT 1
0.338 ms 0 /classes/module/Module.php:2636
544
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 597
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.338 ms 1 /classes/SpecificPrice.php:259
259
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 300 AND `id_group` = 1 LIMIT 1
0.338 ms 0 /classes/GroupReduction.php:156
668
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3501
0.338 ms 1 /classes/Product.php:2902
726
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 125 AND `id_shop` = 1 LIMIT 1
0.337 ms 1 /classes/module/Module.php:2109
670
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2765
0.337 ms 1 /classes/Product.php:2902
724
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 147 AND `id_shop` = 1 LIMIT 1
0.336 ms 1 /classes/module/Module.php:2109
525
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4131 AND `id_group` = 1 LIMIT 1
0.336 ms 0 /classes/GroupReduction.php:156
635
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6293 AND id_shop=1 LIMIT 1
0.336 ms 1 /classes/Product.php:6848
704
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4997
0.336 ms 1 /classes/Product.php:2902
105
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 286 AND `id_group` = 1 LIMIT 1
0.335 ms 0 /classes/GroupReduction.php:156
477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5694
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.335 ms 1 /classes/SpecificPrice.php:259
515
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 595) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.335 ms 1 /classes/stock/StockAvailable.php:453
542
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.335 ms 1 /classes/Product.php:5639
558
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 599 AND id_shop=1 LIMIT 1
0.335 ms 1 /classes/Product.php:6848
659
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8527) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.335 ms 1 /classes/stock/StockAvailable.php:453
56
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_productcomments" LIMIT 1
0.334 ms 0 /classes/module/Module.php:2636
402
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5877 AND `id_group` = 1 LIMIT 1
0.334 ms 0 /classes/GroupReduction.php:156
513
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 595 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6848
526
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:453
588
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 604
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.334 ms 1 /classes/SpecificPrice.php:259
712
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 76 AND `id_shop` = 1 LIMIT 1
0.334 ms 1 /classes/module/Module.php:2109
672
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 405
0.333 ms 1 /classes/Product.php:2902
493
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
602
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6533 AND id_shop=1 LIMIT 1
0.333 ms 1 /classes/Product.php:6848
692
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 599
0.332 ms 1 /classes/Product.php:2902
414
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:453
626
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:453
499
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7920
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.330 ms 1 /classes/SpecificPrice.php:259
646
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7797 AND id_shop=1 LIMIT 1
0.330 ms 1 /classes/Product.php:6848
706
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6293
0.330 ms 1 /classes/Product.php:2902
459
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 9260 AND `id_group` = 1 LIMIT 1
0.329 ms 0 /classes/GroupReduction.php:156
711
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_theme" LIMIT 1
0.329 ms 1 /classes/module/Module.php:2636
470
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4911 AND `id_group` = 1 LIMIT 1
0.328 ms 0 /classes/GroupReduction.php:156
597
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.328 ms 1 /classes/Product.php:5639
716
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_simplefreeshippingline" LIMIT 1
0.328 ms 1 /classes/module/Module.php:2636
727
SELECT SQL_NO_CACHE *
FROM `mangayo_dark_mode` a
WHERE (a.`id` = 1) LIMIT 1
0.328 ms 1 /src/Adapter/EntityMapper.php:71
369
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.326 ms 0 /classes/module/Module.php:2109
407
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.326 ms 1 /classes/Product.php:5639
553
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.326 ms 1 /classes/Product.php:5639
591
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 604 AND id_shop=1 LIMIT 1
0.326 ms 1 /classes/Product.php:6848
469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4911 AND id_shop=1 LIMIT 1
0.325 ms 1 /classes/Product.php:6848
486
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.325 ms 1 /classes/Product.php:5639
514
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 595 AND `id_group` = 1 LIMIT 1
0.325 ms 0 /classes/GroupReduction.php:156
593
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 604) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.324 ms 1 /classes/stock/StockAvailable.php:453
533
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 596
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.321 ms 1 /classes/SpecificPrice.php:259
599
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6533
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.321 ms 1 /classes/SpecificPrice.php:259
720
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.321 ms 1 /classes/module/Module.php:2636
575
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.321 ms 1 /classes/Product.php:5639
571
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 600) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:453
643
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7797
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 1 /classes/SpecificPrice.php:259
717
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 157 AND `id_shop` = 1 LIMIT 1
0.319 ms 1 /classes/module/Module.php:2109
548
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 597 AND `id_group` = 1 LIMIT 1
0.318 ms 0 /classes/GroupReduction.php:156
621
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4997
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.318 ms 1 /classes/SpecificPrice.php:259
652
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.317 ms 1 /classes/Product.php:5639
696
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 602
0.317 ms 1 /classes/Product.php:2902
510
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 595
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.316 ms 1 /classes/SpecificPrice.php:259
538
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 596) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
549
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 597) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:453
586
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.314 ms 1 /classes/Product.php:5639
604
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:453
723
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_client_service" LIMIT 1
0.313 ms 1 /classes/module/Module.php:2636
403
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5877) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
614
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 606 AND `id_group` = 1 LIMIT 1
0.312 ms 0 /classes/GroupReduction.php:156
648
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7797) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:453
710
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8527
0.312 ms 1 /classes/Product.php:2902
637
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.311 ms 1 /classes/stock/StockAvailable.php:453
504
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7920) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:453
715
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 48 LIMIT 1
0.310 ms 1 /classes/Hook.php:244
524
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4131 AND id_shop=1 LIMIT 1
0.309 ms 1 /classes/Product.php:6848
690
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 597
0.307 ms 1 /classes/Product.php:2902
508
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.306 ms 1 /classes/Product.php:5639
580
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 602 AND id_shop=1 LIMIT 1
0.306 ms 1 /classes/Product.php:6848
615
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 606) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
560
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 599) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
547
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 597 AND id_shop=1 LIMIT 1
0.305 ms 1 /classes/Product.php:6848
503
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7920 AND `id_group` = 1 LIMIT 1
0.302 ms 0 /classes/GroupReduction.php:156
613
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 606 AND id_shop=1 LIMIT 1
0.302 ms 1 /classes/Product.php:6848
719
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.301 ms 1 /classes/module/Module.php:2109
718
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.300 ms 1 /classes/module/Module.php:2636
721
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.296 ms 1 /classes/module/Module.php:2109
657
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8527 AND id_shop=1 LIMIT 1
0.293 ms 1 /classes/Product.php:6848
625
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4997 AND `id_group` = 1 LIMIT 1
0.289 ms 0 /classes/GroupReduction.php:156
581
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 602 AND `id_group` = 1 LIMIT 1
0.284 ms 0 /classes/GroupReduction.php:156

Doubles

48 queries
SELECT image_shop.`id_image`
                    FROM `mangayo_image` i
                     INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries
SELECT name FROM mangayo_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries
SELECT *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `mangayo_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
48 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `mangayo_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
48 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries
                            SELECT `id_tax_rules_group`
                            FROM `mangayo_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries
			SELECT `reduction`
			FROM `mangayo_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries
SELECT SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `mangayo_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM mangayo_feature_product pf
                LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN mangayo_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
48 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `mangayo_image` i
             INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
48 queries
SELECT `id_product_attribute`
            FROM `mangayo_product_attribute`
            WHERE `id_product` = XX
34 queries
SELECT `id_module` FROM `mangayo_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
25 queries
            SELECT `id_wishlist`
            FROM `mangayo_an_wishlist`
            WHERE `id_customer` = XX
            AND `is_guest` = XX
            AND `id_shop` = XX LIMIT XX
24 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `mangayo_product_attribute` pa
             INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
24 queries
                SELECT `id_category` FROM `mangayo_category_product`
                WHERE `id_product` = XX
24 queries
            SELECT COUNT(*)
            FROM `mangayo_an_wishlist_products`
            WHERE `id_product` = XX LIMIT XX
24 queries
SELECT out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT product_attribute_shop.id_product_attribute
                FROM mangayo_product_attribute pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
SELECT ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
                    a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
                    IFNULL(stock.quantity, XX) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
                    product_attribute_shop.`default_on`, pa.`reference`, pa.`eanXX`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
                    product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
                    pal.`available_now`, pal.`available_later`
                FROM `mangayo_product_attribute` pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
                LEFT JOIN `mangayo_product_attribute_lang` pal
                    ON (
                        pa.`id_product_attribute` = pal.`id_product_attribute` AND
                        pal.`id_lang` = XX)
                LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
                LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
                LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
                 INNER JOIN mangayo_attribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX)
                WHERE pa.`id_product` = XX
                    AND al.`id_lang` = XX
                    AND agl.`id_lang` = XX
                GROUP BY id_attribute_group, id_product_attribute
                ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
20 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
14 queries
SELECT *
            FROM `mangayo_andropdown` d
            LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
            WHERE d.`id_anmenu` = XX
            AND `id_lang` = XX
            AND `active` = XX
            GROUP BY d.`id_andropdown`
            ORDER BY d.`position` ASC
10 queries
SELECT *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = XX
WHERE (a.`id_cms` = XX) LIMIT XX
10 queries
SELECT *
							FROM `mangayo_cms_lang`
							WHERE `id_cms` = XX AND `id_shop` = XX
6 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"an_megamenu|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
4 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
3 queries
SELECT *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
3 queries
							SELECT `name`
							FROM `mangayo_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries
				SELECT `name`
				FROM `mangayo_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
3 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_linklist|displayFooter|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
3 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_customeraccountlinks|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `mangayo_module` m
                LEFT JOIN `mangayo_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `mangayo_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
SELECT XX FROM `mangayo_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
			SELECT `need_identification_number`
			FROM `mangayo_country`
			WHERE `id_country` = XX LIMIT XX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
			SELECT cl.`link_rewrite`
			FROM `mangayo_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
2 queries
				SELECT tr.*
				FROM `mangayo_tax_rule` tr
				JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = XX) LIMIT XX
2 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX))) GROUP BY fp.id_feature_value
2 queries
SELECT `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=XX) AND (`active`= XX)
2 queries
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
2 queries
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="" AND compile_id="charme" LIMIT XX
2 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"","charme", FROM_UNIXTIME(XX))
2 queries
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="an_megamenu|XX|XX|XX|XX" AND compile_id="charme" LIMIT XX
2 queries
SELECT *
            FROM `mangayo_anmenu` m
            LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
            
            WHERE m.`id_shop` = XX
            AND `id_lang` = XX
            AND `active` = XX
            
            GROUP BY m.`id_anmenu`
            ORDER BY m.`position` ASC
2 queries
SELECT m.*, ml.`description`, ml.`short_description`
            FROM `mangayo_manufacturer` m
             INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)
            LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)
            WHERE m.`id_manufacturer` IN (XX)
            AND m.`active` = XX
            GROUP BY m.`id_manufacturer`
            ORDER BY m.`name`
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) as quantity, pl.`description`,
            pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
            pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
            m.`name` AS manufacturer_name,
            DATEDIFF(
                product_shop.`date_add`,
                DATE_SUB(
                    NOW(),
                    INTERVAL XX DAY
                )
            ) > XX AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
 INNER JOIN mangayo_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = XX AND pl.id_shop = XX 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
 LEFT JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX AND image_shop.cover=XX)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = XX
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
 LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX AND product_attribute_shop.default_on = XX)
 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
WHERE (p.`id_product` IN (XX))
GROUP BY product_shop.id_product
2 queries
SELECT *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = XX
WHERE (a.`id_link_block` = XX) LIMIT XX
2 queries
SELECT *
							FROM `mangayo_link_block_lang`
							WHERE `id_link_block` = XX

Tables stress

158 product
157 product_shop
155 stock_available
129 product_attribute
123 product_attribute_shop
99 image_shop
98 image
97 cart_product
62 category_lang
61 feature_product
55 product_attribute_combination
53 product_lang
52 specific_price
51 image_lang
51 feature_value_lang
49 feature_lang
49 feature
49 feature_shop
48 specific_price_priority
48 product_group_reduction_cache
48 pack
48 attribute
48 attribute_lang
48 attribute_group
44 module
37 module_shop
35 category_product
25 an_wishlist
24 an_productextratabs_labels_relations
24 an_productextratabs_labels_lang
24 an_wishlist_products
24 product_attribute_lang
24 attribute_group_lang
24 attribute_shop
21 category
14 andropdown
14 andropdown_lang
11 category_group
10 hook
10 category_shop
10 manufacturer
10 cms
10 cms_shop
10 cms_lang
6 product_sale
6 smarty_lazy_cache
5 lang
5 country
5 currency
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 manufacturer_shop
4 manufacturer_lang
3 hook_alias
3 image_type
3 feature_value
3 layered_indexable_feature_value_lang_value
3 link_block
3 link_block_shop
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 cart_rule_lang
2 smarty_last_flush
2 tax_rule
2 tax_rules_group
2 social_login_position
2 anmenu
2 anmenu_lang
2 link_block_lang
2 date_range
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 group_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 orders
1 hicookietype
1 hicookietype_lang
1 hicookietype_shop
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 dark_mode
1 an_trust_badges_widgets
1 an_trust_badges_widgets_lang
1 an_trust_badges_icons
1 connections
1 page_type
1 page
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 145 /classes/Link.php:113 (__construct) [id: 284]
/classes/Link.php:113 (__construct) [id: 285]
/classes/Link.php:113 (__construct) [id: 286]
/classes/Link.php:113 (__construct) [id: 287]
/classes/Link.php:113 (__construct) [id: 288]
/classes/Link.php:113 (__construct) [id: 289]
/classes/Link.php:113 (__construct) [id: 290]
/classes/Link.php:113 (__construct) [id: 291]
/classes/Link.php:113 (__construct) [id: 292]
/classes/Link.php:113 (__construct) [id: 293]
/classes/Link.php:113 (__construct) [id: 294]
/classes/Link.php:113 (__construct) [id: 295]
/classes/Link.php:113 (__construct) [id: 296]
/classes/Link.php:113 (__construct) [id: 297]
/classes/Link.php:113 (__construct) [id: 298]
/classes/Link.php:113 (__construct) [id: 299]
/classes/Link.php:113 (__construct) [id: 300]
/classes/Link.php:113 (__construct) [id: 301]
/classes/Link.php:113 (__construct) [id: 302]
/classes/Link.php:113 (__construct) [id: 303]
/classes/Link.php:113 (__construct) [id: 304]
/classes/Link.php:113 (__construct) [id: 305]
/classes/Link.php:113 (__construct) [id: 306]
/classes/Link.php:113 (__construct) [id: 307]
/modules/codwfeeplus/codwfeeplus.php:410 (__construct) [id: 12211]
/classes/Link.php:113 (__construct) [id: 5877]
/classes/Link.php:113 (__construct) [id: 4129]
/classes/Link.php:113 (__construct) [id: 3501]
/classes/Link.php:113 (__construct) [id: 2765]
/classes/Link.php:113 (__construct) [id: 405]
/classes/Link.php:113 (__construct) [id: 9260]
/classes/Link.php:113 (__construct) [id: 4911]
/classes/Link.php:113 (__construct) [id: 5694]
/classes/Link.php:113 (__construct) [id: 6292]
/classes/Link.php:113 (__construct) [id: 7920]
/classes/Link.php:113 (__construct) [id: 595]
/classes/Link.php:113 (__construct) [id: 4131]
/classes/Link.php:113 (__construct) [id: 596]
/classes/Link.php:113 (__construct) [id: 597]
/classes/Link.php:113 (__construct) [id: 599]
/classes/Link.php:113 (__construct) [id: 600]
/classes/Link.php:113 (__construct) [id: 602]
/classes/Link.php:113 (__construct) [id: 604]
/classes/Link.php:113 (__construct) [id: 6533]
/classes/Link.php:113 (__construct) [id: 606]
/classes/Link.php:113 (__construct) [id: 4997]
/classes/Link.php:113 (__construct) [id: 6293]
/classes/Link.php:113 (__construct) [id: 7797]
/classes/Link.php:113 (__construct) [id: 8527]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5877]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4129]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3501]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2765]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 405]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9260]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4911]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5694]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6292]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7920]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 595]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4131]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 596]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 597]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 599]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 600]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 602]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 604]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6533]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 606]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4997]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6293]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7797]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8527]
/classes/Link.php:113 (__construct) [id: 5877]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5877]
/classes/Link.php:113 (__construct) [id: 5877]
/classes/Link.php:113 (__construct) [id: 4129]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4129]
/classes/Link.php:113 (__construct) [id: 4129]
/classes/Link.php:113 (__construct) [id: 3501]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3501]
/classes/Link.php:113 (__construct) [id: 3501]
/classes/Link.php:113 (__construct) [id: 2765]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 2765]
/classes/Link.php:113 (__construct) [id: 2765]
/classes/Link.php:113 (__construct) [id: 405]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 405]
/classes/Link.php:113 (__construct) [id: 405]
/classes/Link.php:113 (__construct) [id: 9260]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 9260]
/classes/Link.php:113 (__construct) [id: 9260]
/classes/Link.php:113 (__construct) [id: 4911]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4911]
/classes/Link.php:113 (__construct) [id: 4911]
/classes/Link.php:113 (__construct) [id: 5694]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5694]
/classes/Link.php:113 (__construct) [id: 5694]
/classes/Link.php:113 (__construct) [id: 6292]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6292]
/classes/Link.php:113 (__construct) [id: 6292]
/classes/Link.php:113 (__construct) [id: 7920]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7920]
/classes/Link.php:113 (__construct) [id: 7920]
/classes/Link.php:113 (__construct) [id: 595]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 595]
/classes/Link.php:113 (__construct) [id: 595]
/classes/Link.php:113 (__construct) [id: 4131]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4131]
/classes/Link.php:113 (__construct) [id: 4131]
/classes/Link.php:113 (__construct) [id: 596]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 596]
/classes/Link.php:113 (__construct) [id: 596]
/classes/Link.php:113 (__construct) [id: 597]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 597]
/classes/Link.php:113 (__construct) [id: 597]
/classes/Link.php:113 (__construct) [id: 599]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 599]
/classes/Link.php:113 (__construct) [id: 599]
/classes/Link.php:113 (__construct) [id: 600]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 600]
/classes/Link.php:113 (__construct) [id: 600]
/classes/Link.php:113 (__construct) [id: 602]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 602]
/classes/Link.php:113 (__construct) [id: 602]
/classes/Link.php:113 (__construct) [id: 604]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 604]
/classes/Link.php:113 (__construct) [id: 604]
/classes/Link.php:113 (__construct) [id: 6533]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6533]
/classes/Link.php:113 (__construct) [id: 6533]
/classes/Link.php:113 (__construct) [id: 606]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 606]
/classes/Link.php:113 (__construct) [id: 606]
/classes/Link.php:113 (__construct) [id: 4997]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4997]
/classes/Link.php:113 (__construct) [id: 4997]
/classes/Link.php:113 (__construct) [id: 6293]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6293]
/classes/Link.php:113 (__construct) [id: 6293]
/classes/Link.php:113 (__construct) [id: 7797]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7797]
/classes/Link.php:113 (__construct) [id: 7797]
/classes/Link.php:113 (__construct) [id: 8527]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8527]
/classes/Link.php:113 (__construct) [id: 8527]
Category 11 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 88]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 90]
/classes/Meta.php:380 (__construct) [id: 11]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/facebookproductad/lib/pixel/pixelCategory.php:46 (__construct) [id: 11]
/modules/facebookproductad/lib/moduleTools.php:481 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 11]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 11]
CMS 11 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 0]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 16]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 3]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 1]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 19]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 8]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 9]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 10]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 11]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 15]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 23]
Country 7 /config/config.inc.php:146 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1725 (__construct) [id: 10]
/modules/paypal/paypal.php:324 (__construct) [id: 10]
/modules/paypal/classes/AbstractMethodPaypal.php:90 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/modules/ps_contactinfo/ps_contactinfo.php:104 (__construct) [id: 10]
State 5 /classes/AddressFormat.php:404 (__construct) [id: 211]
/classes/controller/FrontController.php:1724 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:93 (__construct) [id: 211]
/classes/AddressFormat.php:404 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:103 (__construct) [id: 211]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3691 (initialize) [id: ]
/classes/Product.php:3801 (__construct) [id: ]
/classes/Product.php:5936 (__construct) [id: ]
Language 4 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:559 (__construct) [id: 1]
/modules/facebookproductad/lib/hook/hookDisplay.php:90 (__construct) [id: 1]
/modules/facebookproductad/lib/pixel/pixelCategory.php:39 (__construct) [id: 1]
Cart 4 /classes/controller/FrontController.php:429 (__construct) [id: ]
/classes/controller/FrontController.php:499 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Configuration 2 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 2 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
AddressFormat 2 /classes/controller/FrontController.php:1719 (generateAddress) [id: ]
/modules/ps_contactinfo/ps_contactinfo.php:98 (generateAddress) [id: ]
Hook 2 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
PrestaShop\Module\LinkList\Model\LinkBlock 2 /modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 1]
/modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 6]
BoldizArt\DarkMode\Model\DarkModeOptionsModel 2 /modules/darkmode/darkmode.php:227 (__construct) [id: 1]
/modules/darkmode/darkmode.php:227 (__construct) [id: 1]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:687 (getCurrencyInstance) [id: 1]
OrderState 2 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
ImageType 1 /modules/an_brandslider/an_brandslider.php:440 (__construct) [id: 14]
Risk 1 /classes/controller/FrontController.php:1652 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1649 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/api-platform/core/src/deprecation.php
40 /vendor/api-platform/core/src/Api/FilterInterface.php
41 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
42 /vendor/api-platform/core/src/deprecated_interfaces.php
43 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
58 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
61 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
62 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
65 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
66 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
67 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
68 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
69 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
70 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
71 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
72 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
73 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
74 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
75 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
76 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
77 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
78 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
88 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
89 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
97 /vendor/psr/container/src/ContainerInterface.php
98 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
99 /vendor/ircmaxell/password-compat/lib/password.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /src/Core/Session/SessionHandler.php
171 /src/Core/Session/SessionHandlerInterface.php
172 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
173 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
174 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
175 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
176 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
177 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
188 /config/smarty.config.inc.php
189 /classes/Smarty/SmartyCustom.php
190 /vendor/smarty/smarty/libs/Smarty.class.php
191 /vendor/smarty/smarty/libs/functions.php
192 /vendor/smarty/smarty/libs/Autoloader.php
193 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
194 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
195 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
196 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
197 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
202 /config/smartyfront.config.inc.php
203 /classes/Smarty/SmartyResourceModule.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
206 /classes/Smarty/SmartyResourceParent.php
207 /classes/Smarty/SmartyLazyRegister.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
209 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
210 /classes/Customer.php
211 /classes/Group.php
212 /classes/Link.php
213 /classes/shop/ShopUrl.php
214 /classes/Dispatcher.php
215 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
216 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
217 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
218 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
219 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
222 /src/Adapter/SymfonyContainer.php
223 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
224 /config/db_slave_server.inc.php
225 /modules/anblog/anblog.php
226 /modules/anblog/loader.php
227 /modules/anblog/classes/config.php
228 /modules/anblog/config.php
229 /modules/anblog/libs/Helper.php
230 /modules/anblog/libs/AnblogImage.php
231 /modules/anblog/classes/anBlogLikes.php
232 /modules/anblog/classes/anblogcat.php
233 /modules/anblog/classes/blog.php
234 /modules/anblog/classes/link.php
235 /modules/anblog/classes/comment.php
236 /modules/anblog/classes/sitemap.php
237 /modules/anblog/classes/anBlogWidgets.php
238 /src/Core/Security/Hashing.php
239 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
241 /classes/Translate.php
242 /modules/anblog/translations/it.php
243 /src/PrestaShopBundle/Translation/TranslatorComponent.php
244 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
246 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
247 /vendor/symfony/contracts/Translation/TranslatorInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
249 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
250 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
258 /vendor/symfony/contracts/Translation/TranslatorTrait.php
259 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
261 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
262 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
263 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
264 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
266 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
267 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
268 /override/controllers/front/listing/CategoryController.php
269 /controllers/front/listing/CategoryController.php
270 /classes/controller/ProductListingFrontController.php
271 /classes/controller/ProductPresentingFrontController.php
272 /classes/controller/FrontController.php
273 /src/Adapter/Presenter/Object/ObjectPresenter.php
274 /src/Adapter/Presenter/PresenterInterface.php
275 /src/Adapter/Presenter/Cart/CartPresenter.php
276 /src/Adapter/Product/PriceFormatter.php
277 /src/Adapter/Image/ImageRetriever.php
278 /classes/tax/TaxConfiguration.php
279 /classes/Smarty/TemplateFinder.php
280 /classes/assets/StylesheetManager.php
281 /classes/assets/AbstractAssetManager.php
282 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
283 /classes/assets/JavascriptManager.php
284 /classes/assets/CccReducer.php
285 /classes/Category.php
286 /classes/webservice/WebserviceRequest.php
287 /src/Adapter/ContainerBuilder.php
288 /src/Adapter/Environment.php
289 /src/Core/EnvironmentInterface.php
290 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
291 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
292 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
293 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
294 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
295 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
296 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
297 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
298 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
299 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
300 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
301 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
302 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
303 /vendor/symfony/contracts/Service/ResetInterface.php
304 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
305 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
306 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
308 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
309 /vendor/symfony/contracts/Cache/ItemInterface.php
310 /vendor/psr/cache/src/CacheItemInterface.php
311 /vendor/psr/cache/src/CacheItemPoolInterface.php
312 /vendor/symfony/contracts/Cache/CacheInterface.php
313 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
315 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
317 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
318 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
319 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
321 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
325 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
326 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
327 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
328 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
330 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
332 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
333 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
334 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
335 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
374 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
375 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
376 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
377 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
378 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
381 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
382 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
383 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
384 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
385 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
386 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
387 /var/cache/dev/FrontContainer.php
388 /src/Adapter/Container/LegacyContainer.php
389 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
390 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
391 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
392 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
393 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
394 /vendor/psr/container/src/ContainerExceptionInterface.php
395 /vendor/psr/container/src/NotFoundExceptionInterface.php
396 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
397 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
399 /src/Adapter/Container/LegacyContainerInterface.php
400 /modules/contactform/vendor/autoload.php
401 /modules/contactform/vendor/composer/autoload_real.php
402 /modules/contactform/vendor/composer/autoload_static.php
403 /modules/dashactivity/vendor/autoload.php
404 /modules/dashactivity/vendor/composer/autoload_real.php
405 /modules/dashactivity/vendor/composer/autoload_static.php
406 /modules/dashtrends/vendor/autoload.php
407 /modules/dashtrends/vendor/composer/autoload_real.php
408 /modules/dashtrends/vendor/composer/autoload_static.php
409 /modules/dashproducts/vendor/autoload.php
410 /modules/dashproducts/vendor/composer/autoload_real.php
411 /modules/dashproducts/vendor/composer/autoload_static.php
412 /modules/graphnvd3/vendor/autoload.php
413 /modules/graphnvd3/vendor/composer/autoload_real.php
414 /modules/graphnvd3/vendor/composer/autoload_static.php
415 /modules/gridhtml/vendor/autoload.php
416 /modules/gridhtml/vendor/composer/autoload_real.php
417 /modules/gridhtml/vendor/composer/autoload_static.php
418 /modules/ps_banner/vendor/autoload.php
419 /modules/ps_banner/vendor/composer/autoload_real.php
420 /modules/ps_banner/vendor/composer/platform_check.php
421 /modules/ps_banner/vendor/composer/autoload_static.php
422 /modules/ps_categorytree/vendor/autoload.php
423 /modules/ps_categorytree/vendor/composer/autoload_real.php
424 /modules/ps_categorytree/vendor/composer/platform_check.php
425 /modules/ps_categorytree/vendor/composer/autoload_static.php
426 /modules/ps_contactinfo/vendor/autoload.php
427 /modules/ps_contactinfo/vendor/composer/autoload_real.php
428 /modules/ps_contactinfo/vendor/composer/platform_check.php
429 /modules/ps_contactinfo/vendor/composer/autoload_static.php
430 /modules/ps_currencyselector/vendor/autoload.php
431 /modules/ps_currencyselector/vendor/composer/autoload_real.php
432 /modules/ps_currencyselector/vendor/composer/platform_check.php
433 /modules/ps_currencyselector/vendor/composer/autoload_static.php
434 /modules/ps_customeraccountlinks/vendor/autoload.php
435 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
436 /modules/ps_customeraccountlinks/vendor/composer/platform_check.php
437 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
438 /modules/ps_customersignin/vendor/autoload.php
439 /modules/ps_customersignin/vendor/composer/autoload_real.php
440 /modules/ps_customersignin/vendor/composer/platform_check.php
441 /modules/ps_customersignin/vendor/composer/autoload_static.php
442 /modules/ps_customtext/vendor/autoload.php
443 /modules/ps_customtext/vendor/composer/autoload_real.php
444 /modules/ps_customtext/vendor/composer/platform_check.php
445 /modules/ps_customtext/vendor/composer/autoload_static.php
446 /modules/ps_emailsubscription/vendor/autoload.php
447 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
448 /modules/ps_emailsubscription/vendor/composer/platform_check.php
449 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
450 /modules/ps_faviconnotificationbo/vendor/autoload.php
451 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
452 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
453 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
454 /modules/ps_featuredproducts/vendor/autoload.php
455 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
456 /modules/ps_featuredproducts/vendor/composer/platform_check.php
457 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
458 /modules/ps_languageselector/vendor/autoload.php
459 /modules/ps_languageselector/vendor/composer/autoload_real.php
460 /modules/ps_languageselector/vendor/composer/platform_check.php
461 /modules/ps_languageselector/vendor/composer/autoload_static.php
462 /modules/ps_linklist/vendor/autoload.php
463 /modules/ps_linklist/vendor/composer/autoload_real.php
464 /modules/ps_linklist/vendor/composer/platform_check.php
465 /modules/ps_linklist/vendor/composer/autoload_static.php
466 /modules/ps_mainmenu/vendor/autoload.php
467 /modules/ps_mainmenu/vendor/composer/autoload_real.php
468 /modules/ps_mainmenu/vendor/composer/platform_check.php
469 /modules/ps_mainmenu/vendor/composer/autoload_static.php
470 /modules/ps_searchbar/vendor/autoload.php
471 /modules/ps_searchbar/vendor/composer/autoload_real.php
472 /modules/ps_searchbar/vendor/composer/platform_check.php
473 /modules/ps_searchbar/vendor/composer/autoload_static.php
474 /modules/ps_sharebuttons/vendor/autoload.php
475 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
476 /modules/ps_sharebuttons/vendor/composer/platform_check.php
477 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
478 /modules/ps_shoppingcart/vendor/autoload.php
479 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
480 /modules/ps_shoppingcart/vendor/composer/platform_check.php
481 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
482 /modules/ps_socialfollow/vendor/autoload.php
483 /modules/ps_socialfollow/vendor/composer/autoload_real.php
484 /modules/ps_socialfollow/vendor/composer/platform_check.php
485 /modules/ps_socialfollow/vendor/composer/autoload_static.php
486 /modules/ps_themecusto/vendor/autoload.php
487 /modules/ps_themecusto/vendor/composer/autoload_real.php
488 /modules/ps_themecusto/vendor/composer/platform_check.php
489 /modules/ps_themecusto/vendor/composer/autoload_static.php
490 /modules/pagesnotfound/vendor/autoload.php
491 /modules/pagesnotfound/vendor/composer/autoload_real.php
492 /modules/pagesnotfound/vendor/composer/autoload_static.php
493 /modules/psgdpr/vendor/autoload.php
494 /modules/psgdpr/vendor/composer/autoload_real.php
495 /modules/psgdpr/vendor/composer/autoload_static.php
496 /modules/ps_facetedsearch/vendor/autoload.php
497 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
498 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
499 /modules/ps_categoryproducts/vendor/autoload.php
500 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
501 /modules/ps_categoryproducts/vendor/composer/platform_check.php
502 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
503 /modules/ps_viewedproduct/vendor/autoload.php
504 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
505 /modules/ps_viewedproduct/vendor/composer/platform_check.php
506 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
507 /modules/ps_crossselling/vendor/autoload.php
508 /modules/ps_crossselling/vendor/composer/autoload_real.php
509 /modules/ps_crossselling/vendor/composer/platform_check.php
510 /modules/ps_crossselling/vendor/composer/autoload_static.php
511 /modules/ps_bestsellers/vendor/autoload.php
512 /modules/ps_bestsellers/vendor/composer/autoload_real.php
513 /modules/ps_bestsellers/vendor/composer/platform_check.php
514 /modules/ps_bestsellers/vendor/composer/autoload_static.php
515 /modules/ps_dataprivacy/vendor/autoload.php
516 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
517 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
518 /modules/sociallogin/vendor/autoload.php
519 /modules/sociallogin/vendor/composer/autoload_real.php
520 /modules/sociallogin/vendor/composer/autoload_static.php
521 /modules/sociallogin/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
522 /modules/eicaptcha/vendor/autoload.php
523 /modules/eicaptcha/vendor/composer/autoload_real.php
524 /modules/eicaptcha/vendor/composer/platform_check.php
525 /modules/eicaptcha/vendor/composer/autoload_static.php
526 /modules/eicaptcha/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
527 /modules/eicaptcha/vendor/symfony/string/Resources/functions.php
528 /modules/paypal/vendor/autoload.php
529 /modules/paypal/vendor/composer/autoload_real.php
530 /modules/paypal/vendor/composer/autoload_static.php
531 /modules/paypal/vendor/paragonie/random_compat/lib/random.php
532 /modules/paypal/vendor/symfony/polyfill-php70/bootstrap.php
533 /modules/paypal/vendor/guzzlehttp/psr7/src/functions_include.php
534 /modules/paypal/vendor/guzzlehttp/psr7/src/functions.php
535 /modules/ps_emailalerts/vendor/autoload.php
536 /modules/ps_emailalerts/vendor/composer/autoload_real.php
537 /modules/ps_emailalerts/vendor/composer/platform_check.php
538 /modules/ps_emailalerts/vendor/composer/autoload_static.php
539 /modules/darkmode/vendor/autoload.php
540 /modules/darkmode/vendor/composer/autoload_real.php
541 /modules/darkmode/vendor/composer/platform_check.php
542 /modules/darkmode/vendor/composer/autoload_static.php
543 /modules/payplug/vendor/autoload.php
544 /modules/payplug/vendor/composer/autoload_real.php
545 /modules/payplug/vendor/composer/autoload_static.php
546 /modules/app_endpoint/vendor/autoload.php
547 /modules/app_endpoint/vendor/composer/autoload_real.php
548 /modules/app_endpoint/vendor/composer/platform_check.php
549 /modules/app_endpoint/vendor/composer/autoload_static.php
550 /modules/autoupgrade/vendor/autoload.php
551 /modules/autoupgrade/vendor/composer/autoload_real.php
552 /modules/autoupgrade/vendor/composer/autoload_static.php
553 /modules/ps_specials/vendor/autoload.php
554 /modules/ps_specials/vendor/composer/autoload_real.php
555 /modules/ps_specials/vendor/composer/autoload_static.php
556 /modules/mangayo_assistant/vendor/autoload.php
557 /modules/mangayo_assistant/vendor/composer/autoload_real.php
558 /modules/mangayo_assistant/vendor/composer/autoload_static.php
559 /src/Core/Localization/Locale/Repository.php
560 /src/Core/Localization/Locale/RepositoryInterface.php
561 /src/Core/Localization/CLDR/LocaleRepository.php
562 /src/Core/Localization/CLDR/LocaleDataSource.php
563 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
564 /src/Core/Data/Layer/AbstractDataLayer.php
565 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
566 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
567 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
568 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
569 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
570 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
571 /vendor/symfony/contracts/Cache/CacheTrait.php
572 /vendor/psr/cache/src/InvalidArgumentException.php
573 /vendor/psr/cache/src/CacheException.php
574 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
575 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
576 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
577 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
578 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
579 /src/Core/Localization/CLDR/Reader.php
580 /src/Core/Localization/CLDR/ReaderInterface.php
581 /src/Core/Localization/Currency/Repository.php
582 /src/Core/Localization/Currency/RepositoryInterface.php
583 /src/Core/Localization/Currency/CurrencyDataSource.php
584 /src/Core/Localization/Currency/DataSourceInterface.php
585 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
586 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
587 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
588 /src/Adapter/Currency/CurrencyDataProvider.php
589 /src/Core/Currency/CurrencyDataProviderInterface.php
590 /src/Adapter/LegacyContext.php
591 /src/Adapter/Tools.php
592 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
593 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
594 /vendor/prestashop/decimal/src/Operation/Rounding.php
595 /src/Core/Localization/Locale.php
596 /src/Core/Localization/LocaleInterface.php
597 /src/Core/Localization/Specification/Price.php
598 /src/Core/Localization/Specification/Number.php
599 /src/Core/Localization/Specification/NumberInterface.php
600 /src/Core/Localization/Specification/Factory.php
601 /src/Core/Localization/CLDR/LocaleData.php
602 /src/Core/Localization/CLDR/NumberSymbolsData.php
603 /src/Core/Localization/CLDR/CurrencyData.php
604 /src/Core/Localization/CLDR/Locale.php
605 /src/Core/Localization/CLDR/LocaleInterface.php
606 /src/Core/Localization/Specification/NumberSymbolList.php
607 /classes/Currency.php
608 /src/Core/Localization/Currency/LocalizedCurrencyId.php
609 /src/Core/Localization/Currency/CurrencyData.php
610 /src/Core/Localization/Currency/CurrencyCollection.php
611 /src/Core/Localization/Currency.php
612 /src/Core/Localization/CurrencyInterface.php
613 /src/Core/Localization/Specification/NumberCollection.php
614 /src/Core/Localization/Number/Formatter.php
615 /classes/Cart.php
616 /src/Adapter/AddressFactory.php
617 /classes/CartRule.php
618 /classes/Product.php
619 /src/Core/Domain/Product/ValueObject/RedirectType.php
620 /src/Core/Util/DateTime/DateTime.php
621 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
622 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
623 /src/Core/Domain/Product/ValueObject/ProductType.php
624 /src/Core/Domain/Product/ValueObject/Reference.php
625 /src/Core/Domain/Product/ValueObject/Ean13.php
626 /src/Core/Domain/Product/ValueObject/Isbn.php
627 /src/Core/Domain/Product/ValueObject/Upc.php
628 /src/Core/Domain/Product/ProductSettings.php
629 /src/Core/Domain/Shop/ValueObject/ShopId.php
630 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
631 /modules/ps_emailsubscription/ps_emailsubscription.php
632 /src/Core/Module/WidgetInterface.php
633 /src/PrestaShopBundle/Translation/DomainNormalizer.php
634 /classes/Media.php
635 /modules/ps_socialfollow/ps_socialfollow.php
636 /modules/ps_emailalerts/ps_emailalerts.php
637 /modules/ps_emailalerts/MailAlert.php
638 /classes/ProductDownload.php
639 /classes/tax/Tax.php
640 /src/Core/Localization/CLDR/ComputingPrecision.php
641 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
642 /src/Core/Cart/Calculator.php
643 /src/Core/Cart/CartRowCollection.php
644 /src/Core/Cart/Fees.php
645 /src/Core/Cart/AmountImmutable.php
646 /src/Core/Cart/CartRuleCollection.php
647 /src/Core/Cart/CartRuleCalculator.php
648 /src/Adapter/Product/PriceCalculator.php
649 /classes/order/Order.php
650 /src/Core/Cart/CartRow.php
651 /vendor/prestashop/decimal/src/DecimalNumber.php
652 /vendor/prestashop/decimal/src/Builder.php
653 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
654 /classes/Gender.php
655 /classes/Risk.php
656 /classes/Meta.php
657 /classes/Address.php
658 /classes/ImageType.php
659 /classes/State.php
660 /src/Core/Security/PasswordPolicyConfiguration.php
661 /src/Core/Configuration/DataConfigurationInterface.php
662 /src/Core/Filter/FrontEndObject/MainFilter.php
663 /src/Core/Filter/FilterInterface.php
664 /src/Core/Filter/FrontEndObject/CartFilter.php
665 /src/Core/Filter/HashMapWhitelistFilter.php
666 /src/Core/Filter/CollectionFilter.php
667 /src/Core/Filter/FrontEndObject/ProductFilter.php
668 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
669 /src/Core/Filter/FrontEndObject/CustomerFilter.php
670 /src/Core/Filter/FrontEndObject/ShopFilter.php
671 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
672 /modules/ps_shoppingcart/ps_shoppingcart.php
673 /modules/ets_crosssell/ets_crosssell.php
674 /modules/ets_crosssell/Ets_crosssell_db.php
675 /modules/ets_crosssell/translations/it.php
676 /vendor/defuse/php-encryption/src/Crypto.php
677 /vendor/defuse/php-encryption/src/KeyOrPassword.php
678 /vendor/defuse/php-encryption/src/RuntimeTests.php
679 /vendor/defuse/php-encryption/src/DerivedKeys.php
680 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
681 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
682 /classes/Manufacturer.php
683 /src/Core/Util/String/StringModifier.php
684 /src/Core/Util/String/StringModifierInterface.php
685 /modules/ps_searchbar/ps_searchbar.php
686 /modules/an_productextratabs/an_productextratabs.php
687 /modules/an_productextratabs/classes/anTabsCombinations.php
688 /modules/an_productextratabs/classes/anProductTabs.php
689 /modules/an_productextratabs/classes/anProductTabsTplContent.php
690 /modules/an_productextratabs/classes/anProductTabsLabels.php
691 /modules/an_productextratabs/translations/it.php
692 /modules/an_client_service/an_client_service.php
693 /modules/an_client_service/translations/it.php
694 /modules/an_trust_badges/an_trust_badges.php
695 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php
696 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php
697 /modules/an_trust_badges/translations/it.php
698 /modules/an_user_testimonials/an_user_testimonials.php
699 /modules/an_user_testimonials/classes/AnUserTestimonials.php
700 /modules/an_user_testimonials/translations/it.php
701 /modules/an_accordion/an_accordion.php
702 /modules/an_accordion/classes/AnAccordionBlock.php
703 /modules/an_accordion/translations/it.php
704 /modules/an_homeslider/an_homeslider.php
705 /modules/an_homeslider/classes/anHomeSliderFiles.php
706 /modules/an_homeslider/classes/anHomeSlides.php
707 /modules/an_homeslider/classes/anHomeSliders.php
708 /modules/an_homeslider/hooks_ignore.php
709 /modules/an_homeslider/translations/it.php
710 /modules/an_homeproducts/an_homeproducts.php
711 /modules/an_homeproducts/classes/anHomeProductsBlocks.php
712 /modules/an_homeproducts/classes/anHomeProductFiles.php
713 /modules/an_homeproducts/classes/anHomeProductsBanners.php
714 /modules/an_homeproducts/translations/it.php
715 /modules/an_banners/an_banners.php
716 /modules/an_banners/classes/anBanners.php
717 /modules/an_banners/hooks_ignore.php
718 /modules/an_banners/translations/it.php
719 /modules/an_simplefreeshippingline/an_simplefreeshippingline.php
720 /modules/an_simplefreeshippingline/translations/it.php
721 /modules/an_homecategories/an_homecategories.php
722 /modules/an_homecategories/classes/anHomecatFiles.php
723 /modules/an_homecategories/classes/AnHomecategories.php
724 /modules/an_homecategories/translations/it.php
725 /modules/paypal/paypal.php
726 /modules/paypal/config_prod.php
727 /classes/PaymentModule.php
728 /modules/paypal/classes/Shortcut/ShortcutConfiguration.php
729 /modules/paypal/smarty/plugins/modifier.paypalreplace.php
730 /modules/paypal/translations/it.php
731 /modules/paypal/classes/Constants/PaypalConfigurations.php
732 /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php
733 /modules/paypal/classes/Constants/WebHookConf.php
734 /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php
735 /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php
736 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php
737 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php
738 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php
739 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php
740 /modules/paypal/diagnostic.php
741 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php
742 /modules/paypal/classes/AbstractMethodPaypal.php
743 /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php
744 /modules/paypal/classes/MethodEC.php
745 /modules/paypal/classes/WhiteList/WhiteListService.php
746 /modules/paypal/classes/API/PaypalApiManager.php
747 /modules/paypal/classes/API/PaypalApiManagerInterface.php
748 /modules/paypal/classes/API/PaypalVaultApiManagerInterface.php
749 /modules/paypal/classes/API/PaypalClient.php
750 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalHttpClient.php
751 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/HttpClient.php
752 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/ProductionEnvironment.php
753 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalEnvironment.php
754 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Environment.php
755 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Encoder.php
756 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Json.php
757 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer.php
758 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Text.php
759 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Multipart.php
760 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Form.php
761 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/AuthorizationInjector.php
762 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Injector.php
763 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/GzipInjector.php
764 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/FPTIInstrumentationInjector.php
765 /classes/Smarty/SmartyCustomTemplate.php
766 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
767 /var/cache/dev/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php
768 /modules/anscrolltop/anscrolltop.php
769 /modules/anscrolltop/translations/it.php
770 /modules/darkmode/darkmode.php
771 /src/Adapter/Localization/LegacyTranslator.php
772 /modules/darkmode/translations/it.php
773 /modules/eicaptcha/eicaptcha.php
774 /modules/eicaptcha/translations/it.php
775 /modules/eicaptcha/src/Debugger.php
776 /modules/mangayo_assistant/mangayo_assistant.php
777 /modules/mangayo_assistant/translations/it.php
778 /modules/facebookproductad/facebookproductad.php
779 /modules/facebookproductad/vendor/autoload.php
780 /modules/facebookproductad/vendor/composer/autoload_real.php
781 /modules/facebookproductad/vendor/composer/platform_check.php
782 /modules/facebookproductad/vendor/composer/autoload_static.php
783 /modules/facebookproductad/translations/it.php
784 /modules/facebookproductad/lib/moduleTools.php
785 /modules/facebookproductad/conf/moduleConfiguration.php
786 /modules/facebookproductad/lib/hook/hookController.php
787 /modules/facebookproductad/lib/hook/hookDisplay.php
788 /modules/facebookproductad/lib/hook/hookBase.php
789 /modules/facebookproductad/lib/dao/moduleDao.php
790 /modules/facebookproductad/lib/pixel/basePixel.php
791 /modules/facebookproductad/lib/pixel/pixelCategory.php
792 /classes/Combination.php
793 /classes/stock/StockAvailable.php
794 /classes/SpecificPrice.php
795 /classes/tax/TaxManagerFactory.php
796 /classes/tax/TaxRulesTaxManager.php
797 /classes/tax/TaxManagerInterface.php
798 /classes/tax/TaxCalculator.php
799 /classes/GroupReduction.php
800 /classes/Pack.php
801 /classes/Feature.php
802 /var/cache/dev/smarty/compile/charme/b3/c8/1a/b3c81a5ca82982e30cc717b20aaf37611d4de76f_2.file.header.tpl.php
803 /modules/an_brandslider/an_brandslider.php
804 /modules/an_brandslider/translations/it.php
805 /modules/an_megamenu/an_megamenu.php
806 /modules/an_megamenu/classes/AnMenu.php
807 /modules/an_megamenu/classes/AnDropdown.php
808 /classes/controller/AdminController.php
809 /modules/an_megamenu/composite/AnMegaMenuConfigurator.php
810 /modules/an_megamenu/composite/AnMegaMenuMenuConfigurator.php
811 /modules/an_megamenu/composite/AnMegaMenuHooks.php
812 /modules/an_megamenu/composite/AnMegaMenuAjaxHandler.php
813 /modules/an_megamenu/composite/AnMegaMenuDropDownConfigurator.php
814 /modules/an_productattributes/an_productattributes.php
815 /modules/an_productattributes/classes/anProductAttr.php
816 /modules/an_productattributes/translations/it.php
817 /var/cache/dev/smarty/compile/charme/ed/2e/b6/ed2eb6a7d481b95124e291b11541581f4431489e_2.file.js_header.tpl.php
818 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
819 /modules/an_wishlist/an_wishlist.php
820 /modules/an_wishlist/classes/an_wish.php
821 /modules/an_wishlist/classes/an_wish_products.php
822 /modules/an_wishlist/classes/an_wishListing.php
823 /modules/an_wishlist/translations/it.php
824 /modules/an_stickyaddtocart/an_stickyaddtocart.php
825 /modules/an_stickyaddtocart/translations/it.php
826 /modules/an_theme/an_theme.php
827 /modules/an_theme/classes/InputFactory.php
828 /modules/an_theme/classes/Input.php
829 /modules/an_theme/classes/Validation.php
830 /modules/an_theme/classes/antheme.php
831 /modules/an_theme/classes/anThemeFiles.php
832 /modules/an_theme/translations/it.php
833 /themes/charme/assets/antheme/config/theme_fonts.php
834 /themes/charme/assets/antheme/config/theme_js.php
835 /themes/charme/assets/antheme/config/theme_css.php
836 /themes/charme/assets/antheme/config/vars.php
837 /themes/charme/assets/antheme/config/fields.php
838 /modules/sociallogin/sociallogin.php
839 /modules/sociallogin/translations/it.php
840 /modules/ps_googleanalytics/ps_googleanalytics.php
841 /modules/ps_googleanalytics/vendor/autoload.php
842 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
843 /modules/ps_googleanalytics/vendor/composer/platform_check.php
844 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
845 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
846 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
847 /var/cache/dev/smarty/compile/charme/d2/a4/03/d2a40332993e3600f818db0d45a227f1af331e1a_2.file.ps_googleanalytics.tpl.php
848 /modules/luminage_mail/luminage_mail.php
849 /modules/luminage_mail/translations/it.php
850 /modules/hioutofstocknotification/hioutofstocknotification.php
851 /modules/hioutofstocknotification/classes/HiPrestaModule.php
852 /modules/hioutofstocknotification/classes/outofstock.php
853 /modules/hioutofstocknotification/classes/sentemail.php
854 /modules/hioutofstocknotification/classes/statistic.php
855 /modules/hioutofstocknotification/classes/oosnpdf.php
856 /classes/pdf/HTMLTemplate.php
857 /modules/hioutofstocknotification/classes/adminForms.php
858 /modules/hioutofstocknotification/translations/it.php
859 /var/cache/dev/smarty/compile/charme/b2/c3/47/b2c3472b487ed27b1e317c435a1d8b7f737453cb_2.file.header.tpl.php
860 /modules/ambjolisearch/ambjolisearch.php
861 /modules/ambjolisearch/classes/AmbJolisearchModule.php
862 /modules/ambjolisearch/classes/AmbIndexation.php
863 /modules/ambjolisearch/classes/AmbSearch.php
864 /modules/ambjolisearch/classes/definitions.php
865 /modules/ambjolisearch/classes/JoliLink.php
866 /modules/ambjolisearch/classes/JoliLink-1.7.php
867 /modules/ambjolisearch/classes/AmbJolisearchModuleProxy.php
868 /modules/ambjolisearch/translations/it.php
869 /modules/hicookielaw/hicookielaw.php
870 /modules/hicookielaw/classes/HiPrestaModule.php
871 /modules/hicookielaw/classes/adminForms.php
872 /modules/hicookielaw/classes/consent.php
873 /modules/hicookielaw/classes/type.php
874 /modules/hicookielaw/translations/it.php
875 /var/cache/dev/smarty/compile/charme/0c/8b/7b/0c8b7bc449184adb2e93a99131724c331ff4e737_2.file.header.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
877 /modules/payplug/payplug.php
878 /modules/payplug/translations/it.php
879 /modules/payplug/classes/PayPlugDependencies.php
880 /modules/payplug/classes/DependenciesClass.php
881 /modules/payplug/src/utilities/validators/accountValidator.php
882 /modules/payplug/src/utilities/validators/browserValidator.php
883 /modules/payplug/src/utilities/validators/cardValidator.php
884 /modules/payplug/src/utilities/validators/lockValidator.php
885 /modules/payplug/src/utilities/validators/loggerValidator.php
886 /modules/payplug/src/utilities/validators/moduleValidator.php
887 /modules/payplug/src/utilities/validators/orderValidator.php
888 /modules/payplug/src/utilities/validators/paymentValidator.php
889 /modules/payplug/src/utilities/helpers/AmountHelper.php
890 /modules/payplug/src/utilities/helpers/CookiesHelper.php
891 /modules/payplug/src/utilities/helpers/FilesHelper.php
892 /modules/payplug/src/utilities/helpers/PhoneHelper.php
893 /modules/payplug/src/utilities/helpers/UserHelper.php
894 /modules/payplug/src/application/dependencies/PluginInit.php
895 /modules/payplug/src/application/dependencies/BaseClass.php
896 /modules/payplug/src/actions/CardAction.php
897 /modules/payplug/src/actions/ConfigurationAction.php
898 /modules/payplug/src/actions/MerchantTelemetryAction.php
899 /modules/payplug/src/actions/OnboardingAction.php
900 /modules/payplug/src/actions/OrderStateAction.php
901 /modules/payplug/src/actions/PaymentAction.php
902 /modules/payplug/src/models/entities/CacheEntity.php
903 /modules/payplug/src/models/entities/OneyEntity.php
904 /modules/payplug/src/models/entities/PluginEntity.php
905 /modules/payplug/src/models/entities/OrderStateEntity.php
906 /modules/payplug/src/application/adapter/AddressAdapter.php
907 /modules/payplug/src/interfaces/AddressInterface.php
908 /modules/payplug/src/application/adapter/AssignAdapter.php
909 /modules/payplug/src/interfaces/AssignInterface.php
910 /modules/payplug/src/application/adapter/CarrierAdapter.php
911 /modules/payplug/src/interfaces/CarrierInterface.php
912 /classes/Carrier.php
913 /modules/payplug/src/application/adapter/CartAdapter.php
914 /modules/payplug/src/interfaces/CartInterface.php
915 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
916 /modules/payplug/src/interfaces/ConfigurationInterface.php
917 /modules/payplug/src/application/adapter/ConstantAdapter.php
918 /modules/payplug/src/interfaces/ConstantInterface.php
919 /modules/payplug/src/application/adapter/ContextAdapter.php
920 /modules/payplug/src/interfaces/ContextInterface.php
921 /modules/payplug/src/application/adapter/CountryAdapter.php
922 /modules/payplug/src/interfaces/CountryInterface.php
923 /modules/payplug/src/application/adapter/CurrencyAdapter.php
924 /modules/payplug/src/interfaces/CurrencyInterface.php
925 /modules/payplug/src/application/adapter/CustomerAdapter.php
926 /modules/payplug/src/interfaces/CustomerInterface.php
927 /modules/payplug/src/application/adapter/DispatcherAdapter.php
928 /modules/payplug/src/interfaces/DispatcherInterface.php
929 /modules/payplug/src/application/adapter/LanguageAdapter.php
930 /modules/payplug/src/interfaces/LanguageInterface.php
931 /modules/payplug/src/application/adapter/MediaAdapter.php
932 /modules/payplug/src/interfaces/MediaInterface.php
933 /modules/payplug/src/application/adapter/MessageAdapter.php
934 /modules/payplug/src/interfaces/MessageInterface.php
935 /modules/payplug/src/application/adapter/ModuleAdapter.php
936 /modules/payplug/src/interfaces/ModuleInterface.php
937 /modules/payplug/src/application/adapter/OrderAdapter.php
938 /modules/payplug/src/interfaces/OrderInterface.php
939 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
940 /modules/payplug/src/interfaces/OrderHistoryInterface.php
941 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
942 /modules/payplug/src/interfaces/OrderSlipInterface.php
943 /modules/payplug/src/application/adapter/OrderStateAdapter.php
944 /modules/payplug/src/interfaces/OrderStateInterface.php
945 /classes/order/OrderState.php
946 /modules/payplug/src/application/adapter/ProductAdapter.php
947 /modules/payplug/src/interfaces/ProductInterface.php
948 /modules/payplug/src/application/adapter/QueryAdapter.php
949 /modules/payplug/src/interfaces/QueryInterface.php
950 /modules/payplug/src/application/adapter/ShopAdapter.php
951 /modules/payplug/src/interfaces/ShopInterface.php
952 /modules/payplug/src/application/adapter/ToolsAdapter.php
953 /modules/payplug/src/interfaces/ToolsInterface.php
954 /modules/payplug/src/application/adapter/TranslationAdapter.php
955 /modules/payplug/src/interfaces/TranslationInterface.php
956 /modules/payplug/src/application/adapter/ValidateAdapter.php
957 /modules/payplug/src/interfaces/ValidateInterface.php
958 /modules/payplug/src/models/classes/ApiRest.php
959 /modules/payplug/src/models/classes/Configuration.php
960 /modules/payplug/src/models/classes/Country.php
961 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
962 /modules/payplug/src/models/classes/Translation.php
963 /modules/payplug/translations/en.php
964 /modules/payplug/src/models/repositories/CardRepository.php
965 /modules/payplug/src/models/repositories/QueryRepository.php
966 /modules/payplug/src/models/repositories/CacheRepository.php
967 /modules/payplug/src/models/repositories/CountryRepository.php
968 /modules/payplug/src/models/repositories/LockRepository.php
969 /modules/payplug/src/models/repositories/LoggerRepository.php
970 /modules/payplug/src/models/repositories/ModuleRepository.php
971 /modules/payplug/src/models/repositories/OrderRepository.php
972 /modules/payplug/src/models/repositories/OrderStateRepository.php
973 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
974 /modules/payplug/src/models/repositories/PaymentRepository.php
975 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
976 /modules/payplug/src/models/repositories/ShopRepository.php
977 /modules/payplug/classes/MyLogPHP.php
978 /modules/payplug/src/repositories/LoggerRepository.php
979 /modules/payplug/src/models/entities/LoggerEntity.php
980 /modules/payplug/src/repositories/TranslationsRepository.php
981 /modules/payplug/src/repositories/SQLtableRepository.php
982 /modules/payplug/src/repositories/CacheRepository.php
983 /modules/payplug/src/repositories/OneyRepository.php
984 /modules/payplug/src/repositories/OrderStateRepository.php
985 /modules/payplug/src/repositories/InstallRepository.php
986 /modules/payplug/src/utilities/services/Browser.php
987 /modules/payplug/src/utilities/services/Routes.php
988 /modules/payplug/src/utilities/services/MerchantTelemetry.php
989 /modules/payplug/classes/ApiClass.php
990 /modules/payplug/classes/ApplePayClass.php
991 /modules/payplug/classes/AmountCurrencyClass.php
992 /modules/payplug/classes/AdminClass.php
993 /modules/payplug/classes/PayplugLock.php
994 /modules/payplug/classes/CartClass.php
995 /modules/payplug/classes/ConfigClass.php
996 /modules/payplug/classes/InstallmentClass.php
997 /modules/payplug/classes/HookClass.php
998 /modules/payplug/classes/MediaClass.php
999 /modules/payplug/classes/OrderClass.php
1000 /modules/payplug/classes/PaymentClass.php
1001 /modules/payplug/classes/RefundClass.php
1002 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1003 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1004 /var/cache/dev/smarty/compile/charme/6a/fd/5e/6afd5effcf983f0813cac21afbfc06523d64a8ee_2.file.messages.tpl.php
1005 /modules/app_endpoint/app_endpoint.php
1006 /modules/app_endpoint/translations/it.php
1007 /modules/codwfeeplus/codwfeeplus.php
1008 /modules/codwfeeplus/CODwFP.php
1009 /modules/codwfeeplus/translations/it.php
1010 /src/Core/Product/Search/ProductSearchContext.php
1011 /src/Core/Product/Search/ProductSearchQuery.php
1012 /src/Core/Product/Search/SortOrder.php
1013 /modules/ps_facetedsearch/ps_facetedsearch.php
1014 /modules/ps_facetedsearch/src/HookDispatcher.php
1015 /modules/ps_facetedsearch/src/Hook/Attribute.php
1016 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1017 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1018 /modules/ps_facetedsearch/src/Hook/Category.php
1019 /modules/ps_facetedsearch/src/Hook/Configuration.php
1020 /modules/ps_facetedsearch/src/Hook/Design.php
1021 /modules/ps_facetedsearch/src/Hook/Feature.php
1022 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1023 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1024 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1025 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1026 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1027 /modules/ps_facetedsearch/src/Hook/Product.php
1028 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1029 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1030 /modules/ps_facetedsearch/src/Filters/Provider.php
1031 /modules/ps_facetedsearch/src/URLSerializer.php
1032 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1033 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1034 /src/Core/Product/Search/FacetsRendererInterface.php
1035 /src/Core/Product/Search/ProductSearchProviderInterface.php
1036 /modules/ps_facetedsearch/src/Filters/Converter.php
1037 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1038 /modules/ambjolisearch/src/Amb_ProductSearchProvider.php
1039 /src/Core/Product/Search/ProductSearchResult.php
1040 /modules/ps_facetedsearch/src/Product/Search.php
1041 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1042 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1043 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1044 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1045 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1046 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1047 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1048 /modules/ps_facetedsearch/src/Filters/Products.php
1049 /modules/ps_facetedsearch/src/Filters/Block.php
1050 /src/Core/Product/Search/Facet.php
1051 /src/Core/Product/Search/Filter.php
1052 /src/Core/Product/Search/FacetCollection.php
1053 /classes/ProductAssembler.php
1054 /classes/ProductPresenterFactory.php
1055 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1056 /src/Adapter/Presenter/Product/ProductPresenter.php
1057 /src/Adapter/Product/ProductColorsRetriever.php
1058 /src/Adapter/HookManager.php
1059 /src/Core/Product/ProductPresentationSettings.php
1060 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1061 /src/Adapter/Presenter/Product/ProductLazyArray.php
1062 /src/Adapter/Presenter/AbstractLazyArray.php
1063 /classes/Image.php
1064 /src/Core/Image/ImageFormatConfiguration.php
1065 /src/Core/Image/ImageFormatConfigurationInterface.php
1066 /classes/FeatureFlag.php
1067 /src/Core/FeatureFlag/FeatureFlagSettings.php
1068 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1069 /vendor/prestashop/decimal/src/Operation/Addition.php
1070 /src/Core/Util/Inflector.php
1071 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1072 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1073 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1074 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1075 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1076 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1077 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1078 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1079 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1080 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1081 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1082 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1083 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1084 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1085 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1086 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1087 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1088 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1089 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1090 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1091 /var/cache/dev/smarty/compile/charme/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1093 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1094 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1095 /var/cache/dev/smarty/compile/charme/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1096 /src/Core/Product/Search/Pagination.php
1097 /modules/sociallogin/models/SocialLoginPosition.php
1098 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/66/81/f1/6681f1287ad4751f4330999bf7e5047ef3e52cec_2.file.category.tpl.php
1099 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ee/8c/21/ee8c21f25c301be5b9dae26ba3672f4427c6aeb2_2.file.product-list.tpl.php
1100 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/c1/e5/02/c1e502525a49748091427e0df780f90846bd9d90_2.file.layout-left-column.tpl.php
1101 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a2/43/0d/a2430dfc6da9bb5b779a9919d46af9cb98017def_2.file.layout-both-columns.tpl.php
1102 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a0/b9/f1/a0b9f11bc34eb90e03108a3780da705e4c424c76_2.file.head.tpl.php
1103 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5c/99/24/5c9924d502b61764c40eeba7cd7dda269692307d_2.file.stylesheets.tpl.php
1104 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/3b/3c/ff/3b3cff40db7c22a4ee30c69b5f51819b85be6d9c_2.file.preload.tpl.php
1105 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ad/54/e6/ad54e66984a22371c20ef3cde2b3e98bd215d8e8_2.file.javascript.tpl.php
1106 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/fd/59/0a/fd590a6b567acb629cd24ef142a6acc3994b20dd_2.file.product-activation.tpl.php
1107 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/6b/40/6a/6b406af67655c04b1b8bc34738282cebbf0034fb_2.file.header.tpl.php
1108 /var/cache/dev/smarty/compile/charme/ba/f0/71/baf0714d120e11446c0237301b6cccbc40531653_2.module.an_simplefreeshippinglineviewstemplatesfrontwidget.tpl.php
1109 /modules/ps_languageselector/ps_languageselector.php
1110 /modules/ps_currencyselector/ps_currencyselector.php
1111 /var/cache/dev/smarty/compile/charme/49/36/e5/4936e564782a528c3079f559922e796453f1af1a_2.module.an_client_serviceviewstemplatesfrontwidget.tpl.php
1112 /modules/darkmode/src/Model/DarkModeOptionsModel.php
1113 /modules/darkmode/src/Db/QueryBuilder.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_clearcache.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1116 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1117 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_cacheresourcefile.php
1118 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1120 /var/cache/dev/smarty/compile/charme/a3/cf/9f/a3cf9f8dbcef1e72a52283b913857be8db6a8b80_2.module.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.cache.php
1121 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1122 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1123 /var/cache/dev/smarty/cache/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php
1124 /modules/ps_customersignin/ps_customersignin.php
1125 /var/cache/dev/smarty/compile/charme/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1126 /src/Core/Security/OpenSsl/OpenSSL.php
1127 /src/Core/Security/OpenSsl/OpenSSLInterface.php
1128 /var/cache/dev/smarty/compile/charme/62/b3/ea/62b3ea25f9be6f347bb81fe6309b35116e17553f_2.module.an_wishlistviewstemplatesfrontnav.tpl.php
1129 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1130 /var/cache/dev/smarty/compile/charme/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1131 /modules/an_logo/an_logo.php
1132 /modules/an_logo/translations/it.php
1133 /var/cache/dev/smarty/compile/charme/74/96/d2/7496d2b81ba6ced33a36c630e03cb86d3b647a4b_2.module.an_logoviewstemplatesfrontlogo.tpl.php
1134 /var/cache/dev/smarty/compile/charme/bd/eb/23/bdeb239cddb118da7e29251e756fe96cb3dbe26b_2.file.an_megamenu.tpl.cache.php
1135 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php
1136 /var/cache/dev/smarty/compile/charme/11/0e/c7/110ec72aa9921d2c382ad628bdb2f0bc5105a617_2.module.ps_searchbarps_searchbar.tpl.php
1137 /var/cache/dev/smarty/compile/charme/6a/4b/17/6a4b178cc6ac5016a51cc4db2dda74b30a8cd612_2.file.an_megamenu_mobile.tpl.cache.php
1138 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php
1139 /modules/paypal/classes/InstallmentBanner/BannerManager.php
1140 /modules/paypal/classes/InstallmentBanner/Banner.php
1141 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/b6/b4/37/b6b437561c01fc88997451a413028764044621b6_2.file.notifications.tpl.php
1142 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5b/7f/12/5b7f12aebdf137ed79e78dddcd112712d43e20b5_2.file.breadcrumb.tpl.php
1143 /modules/ps_categorytree/ps_categorytree.php
1144 /var/cache/dev/smarty/compile/charme/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1145 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1146 /var/cache/dev/smarty/compile/charme/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1147 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/22/46/68/2246682b55d5939ba2438c9cba4d4cef07b7d99c_2.file.products-top.tpl.php
1148 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/e7/d5/5d/e7d55de2607b7a3747d835209dfa0bf329274823_2.file.sort-orders.tpl.php
1149 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/cc/2a/92/cc2a920e103307f38418741dbd6eeb78d4f4244b_2.file.products.tpl.php
1150 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/64/de/36/64de36afa8ae49504410858f9ee0be9233599a2b_2.file.product.tpl.php
1151 /var/cache/dev/smarty/compile/charme/62/77/7b/62777bbf995f423da45bdc9d94b3b2255e0685b7_2.module.an_wishlistviewstemplatesfrontproductminiature.tpl.php
1152 /var/cache/dev/smarty/compile/charme/b8/c2/d3/b8c2d37a7784d2c0bb28c4512a21f9b34473d1ad_2.file.productattributes.tpl.php
1153 /var/cache/dev/smarty/compile/charme/c2/f6/38/c2f6388ad4d70d04993a1b28e28ed73fbe5270a8_2.module.an_productattributesviewstemplatesfrontproductattributeswrapper.tpl.php
1154 /var/cache/dev/smarty/compile/charme/50/e3/6e/50e36e4f3c2a4795be15b313ca9e72dc460a5959_2.file.product-variants.tpl.php
1155 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a9/33/f4/a933f46e6d0f30297d17cc3e63762fa9de0d686c_2.file.pagination.tpl.php
1156 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/03/b6/70/03b67016d311f010e0c867f508f78946bb5f1315_2.file.products-bottom.tpl.php
1157 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/38/2a/57/382a577075ddb0537c28ca99407fca0d658514ed_2.file.footer.tpl.php
1158 /modules/ps_contactinfo/ps_contactinfo.php
1159 /var/cache/dev/smarty/compile/charme/99/92/f3/9992f3fe04dd41bcec1a2029cf07bead637caf4d_2.module.ps_contactinfops_contactinfo.tpl.php
1160 /modules/ps_linklist/ps_linklist.php
1161 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php
1162 /modules/ps_linklist/src/Filter/LinkFilter.php
1163 /modules/ps_linklist/src/Filter/BestSalesRouteFilter.php
1164 /modules/ps_linklist/src/Filter/RouteFilterInterface.php
1165 /modules/ps_linklist/src/LegacyLinkBlockRepository.php
1166 /modules/ps_linklist/src/Model/LinkBlock.php
1167 /classes/CMS.php
1168 /var/cache/dev/smarty/compile/charme/90/65/48/906548e89c8c6025457ddaeffb1980a0c743b872_2.module.ps_linklistviewstemplateshooklinkblock.tpl.cache.php
1169 /var/cache/dev/smarty/cache/ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php
1170 /var/cache/dev/smarty/compile/charme/94/04/dd/9404dddf9d62e01629bc90a9cb65c9dd834a2134_2.module.darkmodeviewstemplatesfrontdarkmode_functions.tpl.cache.php
1171 /var/cache/dev/smarty/cache/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php
1172 /modules/ps_customeraccountlinks/ps_customeraccountlinks.php
1173 /var/cache/dev/smarty/compile/charme/42/f9/46/42f9461127ce7396a601c2484841253ea5ba658f_2.module.ps_customeraccountlinksps_customeraccountlinks.tpl.cache.php
1174 /var/cache/dev/smarty/cache/ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php
1175 /var/cache/dev/smarty/compile/charme/b7/0c/56/b70c564919bbf154e7811f43c0a130bb3dc49f9f_2.file.display_footer.tpl.php
1176 /modules/an_copyright/an_copyright.php
1177 /modules/an_copyright/translations/it.php
1178 /var/cache/dev/smarty/compile/charme/56/a5/c8/56a5c82cce1796d8dbfa7b0b327052e3fece4682_2.module.an_copyrightviewstemplatesfrontwidget.tpl.php
1179 /var/cache/dev/smarty/compile/charme/31/32/2b/31322b94623342814b8c7d4182cfda837762840e_2.module.an_trust_badgesviewstemplatesfrontwidget.tpl.php
1180 /modules/statsdata/statsdata.php
1181 /classes/Guest.php
1182 /classes/Connection.php
1183 /classes/Page.php
1184 /classes/ConnectionsSource.php
1185 /classes/DateRange.php
1186 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1187 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1188 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1189 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1190 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1191 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1192 /var/cache/dev/smarty/compile/charme/9b/b4/49/9bb449ecf8392afc0ebd444efd0e58f7f03bd397_2.file.ga_tag.tpl.php