Manga

Manga

Tutti i manga sono protetti in una perfetta bustina protettiva su misura.

Filtri attivi

  • Categoria : Art Book
  • Categoria : Boys love
  • Categoria : Character Book
  • Categoria : Hentai
  • Categoria : Josei
  • Categoria : Manhua
  • Categoria : Manhwa
  • Categoria : Novel
  • Categoria : Seinen
  • Categoria : Shoujo
  • Categoria : Shoujo-Ai
  • Genere: Ecchi
  • Genere: Harem
  • Genere: Scolastico
Atom - The Beginning 16
  • -20%
  • -20%

Atom - The Beginning 16

5,52 € 6,90 €

Atom - The Beginning Volume: 16 Storia: Makoto Tezuka, Masami Yūki Disegni: Tetsurō Kasahara Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Atom - The Beginning 15
  • -20%
  • -20%

Atom - The Beginning 15

5,52 € 6,90 €

Atom - The Beginning Volume: 15 Storia: Makoto Tezuka, Masami Yūki Disegni: Tetsurō Kasahara Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Atom - The Beginning 14
  • -20%
  • -20%

Atom - The Beginning 14

5,52 € 6,90 €

Atom - The Beginning Volume: 14 Storia: Makoto Tezuka, Masami Yūki Disegni: Tetsurō Kasahara Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Atom - The Beginning 13
  • -20%
  • -20%

Atom - The Beginning 13

5,52 € 6,90 €

Atom - The Beginning Volume: 13 Storia: Makoto Tezuka, Masami Yūki Disegni: Tetsurō Kasahara Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Atom - The Beginning 12
  • -20%
  • -20%

Atom - The Beginning 12

5,52 € 6,90 €

Atom - The Beginning Volume: 12 Storia: Makoto Tezuka, Masami Yūki Disegni: Tetsurō Kasahara Formato: 12x16.9 Editore: JPOP Lingua: Italiano

BJ Alex 14
  • -20%
  • -20%

BJ Alex 14

7,92 € 9,90 €

BJ Alex Volumi: 14 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 7
  • -20%
  • -20%

BJ Alex Box 7

15,84 € 19,80 €

BJ Alex Box 7 Volumi: 13 e 14 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 11
  • -20%
  • -20%

BJ Alex 11

7,92 € 9,90 €

BJ Alex Volumi: 11 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 6
  • -20%
  • -20%

BJ Alex Box 6

15,84 € 19,80 €

BJ Alex Box 6 Volumi: 11 e 12 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 10
  • -20%
  • -20%

BJ Alex 10

7,92 € 9,90 €

BJ Alex Volumi: 10 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 9
  • -20%
  • -20%

BJ Alex 9

7,92 € 9,90 €

BJ Alex Volumi: 9 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 5
  • -20%
  • -20%

BJ Alex Box 5

15,84 € 19,80 €

BJ Alex Box 5 Volumi: 9 e 10 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 8
  • -20%
  • -20%

BJ Alex 8

7,92 € 9,90 €

BJ Alex Volumi: 8 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 4
  • -20%
  • -20%

BJ Alex Box 4

15,84 € 19,80 €

BJ Alex Box 4 Volumi: 7 e 8 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 6
  • -20%
  • -20%

BJ Alex 6

7,92 € 9,90 €

BJ Alex Volumi: 6 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 5
  • -20%
  • -20%

BJ Alex 5

7,92 € 9,90 €

BJ Alex Volumi: 5 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 4
  • -20%
  • -20%

BJ Alex 4

7,92 € 9,90 €

BJ Alex Volumi: 4 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 3
  • -20%
  • -20%

BJ Alex Box 3

15,84 € 19,80 €

BJ Alex Box 3 Volumi: 5 e 6 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 2
  • -20%
  • -20%

BJ Alex Box 2

15,84 € 19,80 €

BJ Alex Box 2 Volumi: 3 e 4 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 1
  • -20%
  • -20%

BJ Alex Box 1

15,84 € 19,80 €

BJ Alex Box 1 Volumi: 1 e 2 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

Kaguya-Sama: Love is War 3
  • -5%
  • -5%

Kaguya-Sama: Love is War 3

6,18 € 6,50 €

Kaguya-Sama: Love is War  Volume: 3 Storia: Aka Akasaka Disegni: Aka Akasaka Formato: 13x18 Editore: Star Comics Lingua: Italiano

Blue Period 13
  • -20%
  • -20%

Blue Period 13

5,20 € 6,50 €

Blue Period Volume: 13 Storia: Tsubasa Yamaguchii Disegni: Tsubasa Yamaguchi Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Blue Period 13 + Nude Model - Bundle
  • -20%
  • -20%

Blue Period 13 + Nude Model...

12,32 € 15,40 €

Blue Period + Nude Model - Bundle Volume: 13 + Raccolta + Shikishi Storia: Tsubasa Yamaguchii Disegni: Tsubasa Yamaguchi Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Blue Period 12
  • -20%
  • -20%

Blue Period 12

5,20 € 6,50 €

Blue Period Volume: 12 Storia: Tsubasa Yamaguchii Disegni: Tsubasa Yamaguchi Formato: 12.5x18 Editore: JPOP Lingua: Italiano

Torna all'inizio
Load Time 1615 ms
Querying Time 1477 ms
Queries 1133
Memory Peak Usage 30.9 Mb
Included Files 1190 files - 12.41 Mb
PrestaShop Cache - Mb
Global vars 0.38 Mb
PrestaShop Version 8.1.2
PHP Version 8.1.27
MySQL Version 10.5.11-MariaDB-1:10.5.11+maria~buster-log
Memory Limit 512M
Max Execution Time 60s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 2.144 ms 2.144 ms 2.89 Mb 3.2 Mb
__construct 0.010 ms 2.154 ms - Mb 3.2 Mb
init 12.367 ms 14.521 ms 0.50 Mb 3.5 Mb
checkAccess 0.002 ms 14.523 ms - Mb 3.5 Mb
setMedia 2.138 ms 16.661 ms 0.10 Mb 3.5 Mb
postProcess 0.001 ms 16.662 ms - Mb 3.5 Mb
initHeader 0.001 ms 16.663 ms - Mb 3.5 Mb
initContent 1289 ms 1305 ms 11.68 Mb 15.2 Mb
initFooter 0.002 ms 1305 ms - Mb 15.2 Mb
display 309.544 ms 1615 ms 15.02 Mb 30.9 Mb
Hook Time Memory Usage
DisplayHeader 230.477 ms 4.89 Mb
DisplayProductPriceBlock 114.321 ms 6.22 Mb
displayFooter 40.051 ms 1.39 Mb
ActionProductFlagsModifier 24.032 ms 1.73 Mb
displayProductListReviews 23.564 ms 1.74 Mb
displayNav2 14.386 ms 0.41 Mb
Header 12.467 ms 0.37 Mb
DisplayBeforeBodyClosingTag 11.722 ms 0.33 Mb
DisplayTop 11.279 ms 0.37 Mb
DisplayMobileMenu 11.102 ms 0.40 Mb
DisplayFooter 10.627 ms 0.07 Mb
displayLeftColumn 2.059 ms 0.06 Mb
displayCopyrightContainer 1.783 ms 0.09 Mb
displayNav1 1.755 ms 0.11 Mb
displayNavFullWidth 1.343 ms 0.08 Mb
DisplayOverrideTemplate 1.126 ms 0.03 Mb
displayCopyrightContainerLeft 0.867 ms 0.06 Mb
displayBanner 0.835 ms 0.04 Mb
displayTopLeft 0.807 ms 0.04 Mb
displayClientService 0.786 ms 0.06 Mb
DisplayNavFullWidth 0.523 ms 0.03 Mb
ActionFrontControllerSetMedia 0.194 ms 0.01 Mb
displayTopRight 0.162 ms - Mb
ProductSearchProvider 0.110 ms - Mb
displayFooterLogo 0.100 ms - Mb
DisplayLeftColumn 0.095 ms 0.07 Mb
ModuleRoutes 0.008 ms - Mb
27 hook(s) 516.580 ms 18.60 Mb
Module Time Memory Usage
anblog 1.848 ms 0.02 Mb
ps_emailsubscription 1.217 ms 0.08 Mb
ps_socialfollow 0.077 ms 0.01 Mb
ps_emailalerts 0.114 ms 0.01 Mb
ps_shoppingcart 1.025 ms 0.06 Mb
ets_crosssell 30.305 ms 0.18 Mb
ps_searchbar 0.308 ms 0.01 Mb
an_productextratabs 24.152 ms 1.75 Mb
an_client_service 0.871 ms 0.07 Mb
an_trust_badges 1.870 ms 0.09 Mb
an_user_testimonials 0.137 ms 0.01 Mb
an_accordion 0.094 ms 0.01 Mb
an_homeslider 0.147 ms 0.01 Mb
an_homeproducts 0.162 ms 0.01 Mb
an_banners 0.093 ms 0.01 Mb
an_simplefreeshippingline 0.923 ms 0.05 Mb
an_homecategories 0.096 ms 0.07 Mb
paypal 2.065 ms 0.17 Mb
anscrolltop 0.241 ms 0.06 Mb
darkmode 20.940 ms 0.36 Mb
eicaptcha 0.109 ms - Mb
mangayo_assistant 0.113 ms 0.01 Mb
facebookproductad 198.346 ms 4.63 Mb
an_brandslider 10.913 ms 0.14 Mb
an_megamenu 22.704 ms 0.83 Mb
an_productattributes 113.752 ms 6.13 Mb
an_wishlist 25.218 ms 1.84 Mb
an_stickyaddtocart 0.090 ms 0.01 Mb
an_theme 1.216 ms 0.10 Mb
sociallogin 4.611 ms 0.14 Mb
ps_googleanalytics 2.450 ms 0.13 Mb
luminage_mail 0.122 ms 0.01 Mb
hioutofstocknotification 0.435 ms 0.03 Mb
ambjolisearch 10.024 ms 0.26 Mb
hicookielaw 1.501 ms 0.04 Mb
payplug 4.904 ms 0.44 Mb
app_endpoint 0.157 ms 0.01 Mb
codwfeeplus 2.539 ms 0.15 Mb
ps_facetedsearch 0.486 ms 0.13 Mb
ps_languageselector 0.766 ms 0.05 Mb
ps_currencyselector 1.103 ms 0.07 Mb
ps_customersignin 0.970 ms 0.07 Mb
an_logo 1.058 ms 0.05 Mb
ps_categorytree 2.119 ms 0.07 Mb
ps_contactinfo 1.639 ms 0.09 Mb
ps_linklist 25.019 ms 1.02 Mb
ps_customeraccountlinks 3.978 ms 0.18 Mb
an_copyright 1.017 ms 0.06 Mb
statsdata 9.520 ms 0.22 Mb
49 module(s) 533.564 ms 19.91 Mb

Stopwatch SQL - 1133 queries

# Query Time (ms) Rows Filesort Group By Location
389 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=4)) AND ((fp_1.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) GROUP BY fp.id_feature_value
 267.309 ms 71221463040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
385 
SELECT SQL_NO_CACHE p.id_product, sa.out_of_stock FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY IFNULL(p.quantity, 0) <= 0, IFNULL(p.quantity, 0) <= 0 AND FIELD(sa.out_of_stock, 1) DESC, p.position ASC, p.id_product DESC LIMIT 0, 24
 160.340 ms 10062341603328 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
386 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46)))
 151.901 ms 19868334080 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
387 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (54, 55, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=3)) AND ((fp_1.id_feature_value IN (54, 55, 46))) GROUP BY fp.id_feature_value
 127.656 ms 51060101120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
394 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM mangayo_product p INNER JOIN mangayo_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28
 90.875 ms 4672 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
393 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46))) AND cg.id_group='1' AND c.nleft>11 AND c.nright<28 GROUP BY cp.id_category
 34.331 ms 1831424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
2 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `mangayo_configuration` c
LEFT JOIN `mangayo_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 8.002 ms 2039 /classes/Configuration.php:180
1129 
SELECT SQL_NO_CACHE `id_date_range`, `time_end`
FROM `mangayo_date_range`
WHERE `time_end` = (SELECT MAX(`time_end`) FROM `mangayo_date_range`) LIMIT 1
 6.112 ms 91431844 /classes/DateRange.php:60
728 
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
 5.818 ms 1 /classes/Smarty/SmartyCustom.php:280
1107 
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
 5.571 ms 1 /classes/Smarty/SmartyCustom.php:280
947 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5773
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 4.757 ms 2 Yes Yes /classes/Product.php:4578
79 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `mangayo_hook_module` hm
STRAIGHT_JOIN `mangayo_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `mangayo_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 3.951 ms 610 /classes/Hook.php:456
805 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7732) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 3.646 ms 1 Yes Yes /classes/Product.php:4504
13 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `mangayo_module` m
INNER JOIN mangayo_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `mangayo_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `mangayo_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `mangayo_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 3.572 ms 182 Yes Yes /classes/Hook.php:1233
290 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 303)
 3.519 ms 1 /classes/Product.php:3857
391 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_1.id_feature_value IN (54, 55, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN mangayo_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=5)) AND ((fp_1.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 14, 38, 43))) AND ((fp_2.id_feature_value IN (54, 55, 46))) GROUP BY fp.id_feature_value
 3.487 ms 1792 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
78 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `mangayo_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `mangayo_hook_alias` ha
INNER JOIN `mangayo_hook` h ON ha.name = h.name
 3.252 ms 0 /classes/Hook.php:1292
65 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-06-28 00:00:00",
INTERVAL 10 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `mangayo_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `mangayo_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `mangayo_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `mangayo_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `mangayo_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 11 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
 3.031 ms 11258 /classes/Category.php:1059
488 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8043
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 3.014 ms 1 /classes/SpecificPrice.php:259
43 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 2.698 ms 0 /classes/module/Module.php:2636
289 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 303) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 2.165 ms 2 Yes /classes/SpecificPrice.php:576
347 
SHOW TABLES LIKE "%mangayo_social_login_%"
 1.808 ms 1 /modules/sociallogin/sociallogin.php:186
395 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-06-28 00:00:00',
INTERVAL 10 DAY
)
) > 0) as new
FROM mangayo_product p
LEFT JOIN mangayo_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN mangayo_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN mangayo_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (10992,9503,7732,6171,2972,9135,8861,8277,8043,7937,7733,7361,6048,5773,5603,5479,5143,5139,4673,4094,404,9194,9171,7315)
 1.783 ms 24 /classes/ProductAssembler.php:95
40 
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
 1.755 ms 178 /classes/CartRule.php:418
959 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5603
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.712 ms 2 Yes Yes /classes/Product.php:4578
487 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8043) AND (b.`id_shop` = 1) LIMIT 1
 1.688 ms 1 /src/Adapter/EntityMapper.php:71
923 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7361
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.677 ms 2 Yes Yes /classes/Product.php:4578
1031 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 404
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.667 ms 2 Yes Yes /classes/Product.php:4578
839 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 2972
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.598 ms 2 Yes Yes /classes/Product.php:4578
1007 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4673
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.596 ms 2 Yes Yes /classes/Product.php:4578
863 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8861
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.583 ms 2 Yes Yes /classes/Product.php:4578
911 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7733
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.581 ms 2 Yes Yes /classes/Product.php:4578
1043 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 9194
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.538 ms 2 Yes Yes /classes/Product.php:4578
791 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 10992
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.517 ms 2 Yes Yes /classes/Product.php:4578
945 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5773 LIMIT 1
 1.495 ms 1 /classes/Product.php:1106
803 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 9503
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.487 ms 2 Yes Yes /classes/Product.php:4578
1019 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4094
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.482 ms 2 Yes Yes /classes/Product.php:4578
1055 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 9171
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.481 ms 2 Yes Yes /classes/Product.php:4578
12 
SELECT SQL_NO_CACHE lower(name) as name
FROM `mangayo_hook` h
WHERE (h.active = 1)
 1.478 ms 986 /classes/Hook.php:1332
827 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6171
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.473 ms 2 Yes Yes /classes/Product.php:4578
58 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
 1.467 ms 40 Yes /classes/Manufacturer.php:211
42 
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
 1.464 ms 1 /classes/CartRule.php:418
983 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5143
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.460 ms 2 Yes Yes /classes/Product.php:4578
851 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 9135
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.455 ms 2 Yes Yes /classes/Product.php:4578
935 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6048
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.454 ms 2 Yes Yes /classes/Product.php:4578
815 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7732
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.452 ms 2 Yes Yes /classes/Product.php:4578
899 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7937
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.448 ms 2 Yes Yes /classes/Product.php:4578
971 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5479
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.447 ms 2 Yes Yes /classes/Product.php:4578
1067 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7315
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.446 ms 2 Yes Yes /classes/Product.php:4578
33 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `mangayo_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 11
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 1.445 ms 7 Yes Yes /classes/Category.php:921
887 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8043
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.435 ms 2 Yes Yes /classes/Product.php:4578
995 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5139
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.430 ms 2 Yes Yes /classes/Product.php:4578
875 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8277
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.425 ms 2 Yes Yes /classes/Product.php:4578
212 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 296) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.307 ms 2 Yes /classes/SpecificPrice.php:576
1132 
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `mangayo_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (10992,9503,7732,6171,2972,9135,8861,8277,8043,7937,7733,7361,6048,5773,5603,5479,5143,5139,4673,4094,404,9194,9171,7315) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
 1.286 ms 70 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
1094 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 8 AND `id_shop` = 1
 1.258 ms 1 /src/Adapter/EntityMapper.php:79
311 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 305) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.254 ms 2 Yes /classes/SpecificPrice.php:576
1070 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
 1.225 ms 40 Yes /classes/Manufacturer.php:211
300 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 304) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.224 ms 2 Yes /classes/SpecificPrice.php:576
15 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `mangayo_hook`
 1.217 ms 986 /classes/Hook.php:1292
124 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 288) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.209 ms 2 Yes /classes/SpecificPrice.php:576
278 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 302) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.203 ms 2 Yes /classes/SpecificPrice.php:576
256 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 300) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.184 ms 2 Yes /classes/SpecificPrice.php:576
267 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 301) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.171 ms 2 Yes /classes/SpecificPrice.php:576
333 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 307) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.163 ms 2 Yes /classes/SpecificPrice.php:576
489 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8043) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.153 ms 3 Yes /classes/SpecificPrice.php:576
147 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 290)
 1.146 ms 1 /classes/Product.php:3857
374 
SELECT SQL_NO_CACHE t.*,
tl.*
FROM `mangayo_hicookietype` t
LEFT JOIN `mangayo_hicookietype_lang` `tl` ON t.`id_type` = tl.`id_type`
LEFT JOIN `mangayo_hicookietype_shop` `ts` ON t.`id_type` = ts.`id_type`
WHERE (tl.`id_lang` = 1) AND (ts.`id_shop` = 1)
ORDER BY t.position
 1.138 ms 9 Yes /modules/hicookielaw/classes/type.php:68
322 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 306) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.119 ms 2 Yes /classes/SpecificPrice.php:576
752 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
 1.114 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
190 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 294) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.104 ms 2 Yes /classes/SpecificPrice.php:576
223 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 297) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.102 ms 2 Yes /classes/SpecificPrice.php:576
113 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 287) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.101 ms 2 Yes /classes/SpecificPrice.php:576
201 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 295) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.079 ms 2 Yes /classes/SpecificPrice.php:576
75 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 284) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.062 ms 2 Yes /classes/SpecificPrice.php:576
234 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 298) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.060 ms 2 Yes /classes/SpecificPrice.php:576
179 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 293) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.059 ms 2 Yes /classes/SpecificPrice.php:576
245 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 299) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.058 ms 2 Yes /classes/SpecificPrice.php:576
767 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
 1.043 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
157 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 291) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.038 ms 2 Yes /classes/SpecificPrice.php:576
1088 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 3 AND `id_shop` = 1
 1.036 ms 1 /src/Adapter/EntityMapper.php:79
135 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 289) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.034 ms 2 Yes /classes/SpecificPrice.php:576
102 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 286) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.032 ms 2 Yes /classes/SpecificPrice.php:576
91 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 285) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.031 ms 2 Yes /classes/SpecificPrice.php:576
168 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 292) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.022 ms 2 Yes /classes/SpecificPrice.php:576
1096 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 9 AND `id_shop` = 1
 1.022 ms 1 /src/Adapter/EntityMapper.php:79
146 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 290) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.013 ms 2 Yes /classes/SpecificPrice.php:576
384 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
 1.008 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
16 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.993 ms 130 /classes/module/Module.php:345
778 
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `mangayo_category` c
INNER JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `mangayo_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 6
AND nleft >= 11 AND nright <= 28
AND c.id_category IN (
SELECT id_category
FROM `mangayo_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cs.`position` ASC
 0.991 ms 9 Yes /modules/ps_categorytree/ps_categorytree.php:166
18 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `mangayo_meta` m
LEFT JOIN `mangayo_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.962 ms 59 Yes /classes/Dispatcher.php:654
305 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 304 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.952 ms 0 /classes/Cart.php:1410
118 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 287 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.945 ms 0 /classes/Cart.php:1410
298 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 304) AND (b.`id_shop` = 1) LIMIT 1
 0.926 ms 1 /src/Adapter/EntityMapper.php:71
766 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.914 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
140 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 289 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 289 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.911 ms 0 /classes/Cart.php:1410
54 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "productcomments" LIMIT 1
 0.909 ms 1 /classes/module/Module.php:2636
188 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 294) AND (b.`id_shop` = 1) LIMIT 1
 0.907 ms 1 /src/Adapter/EntityMapper.php:71
533 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6048) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.902 ms 3 Yes /classes/SpecificPrice.php:576
84 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 284 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.901 ms 0 /classes/Cart.php:1410
747 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.901 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
401 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 10992) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.898 ms 3 Yes /classes/SpecificPrice.php:576
272 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 301 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 301 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.895 ms 0 /classes/Cart.php:1410
151 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 290 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 290 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.893 ms 0 /classes/Cart.php:1410
753 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.892 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
294 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 303 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.891 ms 0 /classes/Cart.php:1410
129 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 288 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 288 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.885 ms 0 /classes/Cart.php:1410
276 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 302) AND (b.`id_shop` = 1) LIMIT 1
 0.885 ms 1 /src/Adapter/EntityMapper.php:71
239 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 298 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.879 ms 0 /classes/Cart.php:1410
217 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 296 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.875 ms 0 /classes/Cart.php:1410
283 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 302 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.873 ms 0 /classes/Cart.php:1410
316 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 305 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.872 ms 0 /classes/Cart.php:1410
173 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 292 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 292 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.871 ms 0 /classes/Cart.php:1410
261 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 300 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 300 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.868 ms 0 /classes/Cart.php:1410
107 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 286 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.867 ms 0 /classes/Cart.php:1410
96 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 285 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.866 ms 0 /classes/Cart.php:1410
309 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 305) AND (b.`id_shop` = 1) LIMIT 1
 0.865 ms 1 /src/Adapter/EntityMapper.php:71
196 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 294
ORDER BY f.position ASC
 0.863 ms 7 Yes /classes/Product.php:5993
804 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9503
 0.862 ms 1 /classes/Product.php:2902
434 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6171) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.861 ms 3 Yes /classes/SpecificPrice.php:576
957 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5603 LIMIT 1
 0.860 ms 1 /classes/Product.php:1106
184 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 293 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.855 ms 0 /classes/Cart.php:1410
588 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5139) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.853 ms 3 Yes /classes/SpecificPrice.php:576
338 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 307 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.852 ms 0 /classes/Cart.php:1410
327 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 306 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.851 ms 0 /classes/Cart.php:1410
250 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 299 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.850 ms 0 /classes/Cart.php:1410
232 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 298) AND (b.`id_shop` = 1) LIMIT 1
 0.850 ms 1 /src/Adapter/EntityMapper.php:71
317 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 305
ORDER BY f.position ASC
 0.849 ms 7 Yes /classes/Product.php:5993
320 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 306) AND (b.`id_shop` = 1) LIMIT 1
 0.849 ms 1 /src/Adapter/EntityMapper.php:71
206 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 295 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.847 ms 0 /classes/Cart.php:1410
218 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 296
ORDER BY f.position ASC
 0.844 ms 7 Yes /classes/Product.php:5993
228 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 297 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.843 ms 0 /classes/Cart.php:1410
467 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8861) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.842 ms 3 Yes /classes/SpecificPrice.php:576
152 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 290
ORDER BY f.position ASC
 0.840 ms 7 Yes /classes/Product.php:5993
195 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 294 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 294 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.838 ms 0 /classes/Cart.php:1410
37 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.837 ms 130 /classes/module/Module.php:345
273 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 301
ORDER BY f.position ASC
 0.837 ms 7 Yes /classes/Product.php:5993
412 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 9503) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.837 ms 3 Yes /classes/SpecificPrice.php:576
210 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 296) AND (b.`id_shop` = 1) LIMIT 1
 0.836 ms 1 /src/Adapter/EntityMapper.php:71
162 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 291 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 291 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.835 ms 0 /classes/Cart.php:1410
522 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7361) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.835 ms 3 Yes /classes/SpecificPrice.php:576
141 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 289
ORDER BY f.position ASC
 0.830 ms 7 Yes /classes/Product.php:5993
130 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 288
ORDER BY f.position ASC
 0.828 ms 7 Yes /classes/Product.php:5993
762 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.827 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
59 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`, cl.`link_rewrite`, category_shop.`id_shop`
FROM `mangayo_category` c
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE `id_lang` = 1
AND c.`id_parent` = 2
AND `active` = 1
GROUP BY c.`id_category`
ORDER BY category_shop.`position` ASC
 0.826 ms 15 Yes Yes /classes/Category.php:1148
287 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 303) AND (b.`id_shop` = 1) LIMIT 1
 0.825 ms 1 /src/Adapter/EntityMapper.php:71
251 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 299
ORDER BY f.position ASC
 0.825 ms 7 Yes /classes/Product.php:5993
448 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 2972 AND `id_group` = 1 LIMIT 1
 0.825 ms 0 /classes/GroupReduction.php:156
761 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.822 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
254 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 300) AND (b.`id_shop` = 1) LIMIT 1
 0.818 ms 1 /src/Adapter/EntityMapper.php:71
382 
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `mangayo_feature` f  INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `mangayo_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `mangayo_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
 0.817 ms 49 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
97 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 285
ORDER BY f.position ASC
 0.809 ms 7 Yes /classes/Product.php:5993
85 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 284
ORDER BY f.position ASC
 0.803 ms 7 Yes /classes/Product.php:5993
622 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 404) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.792 ms 2 Yes /classes/SpecificPrice.php:576
306 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 304
ORDER BY f.position ASC
 0.791 ms 7 Yes /classes/Product.php:5993
41 
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.791 ms 465 /classes/CartRule.php:357
997 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4673) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.788 ms 1 Yes Yes /classes/Product.php:4504
19 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
 0.786 ms 1 /src/Adapter/EntityMapper.php:71
108 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 286
ORDER BY f.position ASC
 0.785 ms 7 Yes /classes/Product.php:5993
383 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
 0.785 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
229 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 297
ORDER BY f.position ASC
 0.781 ms 7 Yes /classes/Product.php:5993
328 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 306
ORDER BY f.position ASC
 0.781 ms 7 Yes /classes/Product.php:5993
207 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 295
ORDER BY f.position ASC
 0.779 ms 7 Yes /classes/Product.php:5993
1057 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7315) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.778 ms 1 Yes Yes /classes/Product.php:4504
174 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 292
ORDER BY f.position ASC
 0.777 ms 7 Yes /classes/Product.php:5993
185 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 293
ORDER BY f.position ASC
 0.776 ms 7 Yes /classes/Product.php:5993
390 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
 0.776 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
295 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 303
ORDER BY f.position ASC
 0.775 ms 7 Yes /classes/Product.php:5993
89 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 285) AND (b.`id_shop` = 1) LIMIT 1
 0.774 ms 1 /src/Adapter/EntityMapper.php:71
262 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 300
ORDER BY f.position ASC
 0.774 ms 7 Yes /classes/Product.php:5993
284 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 302
ORDER BY f.position ASC
 0.774 ms 7 Yes /classes/Product.php:5993
119 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 287
ORDER BY f.position ASC
 0.771 ms 7 Yes /classes/Product.php:5993
240 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 298
ORDER BY f.position ASC
 0.767 ms 7 Yes /classes/Product.php:5993
331 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 307) AND (b.`id_shop` = 1) LIMIT 1
 0.767 ms 1 /src/Adapter/EntityMapper.php:71
163 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 291
ORDER BY f.position ASC
 0.757 ms 7 Yes /classes/Product.php:5993
144 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 290) AND (b.`id_shop` = 1) LIMIT 1
 0.756 ms 1 /src/Adapter/EntityMapper.php:71
166 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 292) AND (b.`id_shop` = 1) LIMIT 1
 0.756 ms 1 /src/Adapter/EntityMapper.php:71
339 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 307
ORDER BY f.position ASC
 0.756 ms 7 Yes /classes/Product.php:5993
445 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 2972) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.756 ms 3 Yes /classes/SpecificPrice.php:576
39 
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.753 ms 465 /classes/CartRule.php:357
768 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.749 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
748 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.746 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
177 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 293) AND (b.`id_shop` = 1) LIMIT 1
 0.745 ms 1 /src/Adapter/EntityMapper.php:71
644 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 9171) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.743 ms 3 Yes /classes/SpecificPrice.php:576
133 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 289) AND (b.`id_shop` = 1) LIMIT 1
 0.739 ms 1 /src/Adapter/EntityMapper.php:71
122 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 288) AND (b.`id_shop` = 1) LIMIT 1
 0.738 ms 1 /src/Adapter/EntityMapper.php:71
221 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 297) AND (b.`id_shop` = 1) LIMIT 1
 0.736 ms 1 /src/Adapter/EntityMapper.php:71
754 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.735 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
456 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 9135) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.733 ms 3 Yes /classes/SpecificPrice.php:576
763 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.733 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
751 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.732 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
566 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5479) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.731 ms 3 Yes /classes/SpecificPrice.php:576
155 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 291) AND (b.`id_shop` = 1) LIMIT 1
 0.730 ms 1 /src/Adapter/EntityMapper.php:71
377 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12211) LIMIT 1
 0.727 ms 1 /src/Adapter/EntityMapper.php:71
52 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a0
LEFT JOIN `mangayo_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 11) AND (a0.`nright` > 28) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.724 ms 6 /classes/PrestaShopCollection.php:383
111 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 287) AND (b.`id_shop` = 1) LIMIT 1
 0.723 ms 1 /src/Adapter/EntityMapper.php:71
100 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 286) AND (b.`id_shop` = 1) LIMIT 1
 0.722 ms 1 /src/Adapter/EntityMapper.php:71
243 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 299) AND (b.`id_shop` = 1) LIMIT 1
 0.722 ms 1 /src/Adapter/EntityMapper.php:71
69 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 284) AND (b.`id_shop` = 1) LIMIT 1
 0.716 ms 1 /src/Adapter/EntityMapper.php:71
564 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5479) AND (b.`id_shop` = 1) LIMIT 1
 0.715 ms 1 /src/Adapter/EntityMapper.php:71
199 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 295) AND (b.`id_shop` = 1) LIMIT 1
 0.714 ms 1 /src/Adapter/EntityMapper.php:71
323 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 306)
 0.714 ms 1 /classes/Product.php:3857
125 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 288)
 0.712 ms 1 /classes/Product.php:3857
599 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4673) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.708 ms 3 Yes /classes/SpecificPrice.php:576
544 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5773) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.706 ms 3 Yes /classes/SpecificPrice.php:576
265 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 301) AND (b.`id_shop` = 1) LIMIT 1
 0.705 ms 1 /src/Adapter/EntityMapper.php:71
927 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6048)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.705 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
423 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7732) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.704 ms 3 Yes /classes/SpecificPrice.php:576
1100 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 11 AND `id_shop` = 1
 0.704 ms 1 /src/Adapter/EntityMapper.php:79
34 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 88) AND (b.`id_shop` = 1) LIMIT 1
 0.703 ms 1 /src/Adapter/EntityMapper.php:71
746 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.700 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
760 
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
 0.699 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
334 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 307)
 0.699 ms 1 /classes/Product.php:3857
889 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7937) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.696 ms 1 Yes Yes /classes/Product.php:4504
511 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7733) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.696 ms 3 Yes /classes/SpecificPrice.php:576
500 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7937) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.693 ms 3 Yes /classes/SpecificPrice.php:576
555 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5603) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.693 ms 3 Yes /classes/SpecificPrice.php:576
765 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.690 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
478 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8277) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.689 ms 3 Yes /classes/SpecificPrice.php:576
655 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7315) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.689 ms 3 Yes /classes/SpecificPrice.php:576
769 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.689 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
577 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5143) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.685 ms 3 Yes /classes/SpecificPrice.php:576
542 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5773) AND (b.`id_shop` = 1) LIMIT 1
 0.685 ms 1 /src/Adapter/EntityMapper.php:71
1 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM mangayo_shop_group gs
LEFT JOIN mangayo_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN mangayo_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.684 ms 1 Yes /classes/shop/Shop.php:715
633 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 9194) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.677 ms 3 Yes /classes/SpecificPrice.php:576
819 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6171)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.677 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
610 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4094) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.676 ms 2 Yes /classes/SpecificPrice.php:576
498 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7937) AND (b.`id_shop` = 1) LIMIT 1
 0.674 ms 1 /src/Adapter/EntityMapper.php:71
608 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4094) AND (b.`id_shop` = 1) LIMIT 1
 0.671 ms 1 /src/Adapter/EntityMapper.php:71
392 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
 0.663 ms 87 Yes /classes/Category.php:721
619 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 404) AND (b.`id_shop` = 1) LIMIT 1
 0.661 ms 1 /src/Adapter/EntityMapper.php:71
817 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6171) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.660 ms 1 Yes Yes /classes/Product.php:4504
509 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7733) AND (b.`id_shop` = 1) LIMIT 1
 0.659 ms 1 /src/Adapter/EntityMapper.php:71
531 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6048) AND (b.`id_shop` = 1) LIMIT 1
 0.653 ms 1 /src/Adapter/EntityMapper.php:71
398 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10992) AND (b.`id_shop` = 1) LIMIT 1
 0.652 ms 1 /src/Adapter/EntityMapper.php:71
378 
SELECT SQL_NO_CACHE *
FROM `mangayo_product_lang`
WHERE `id_product` = 12211 AND `id_shop` = 1
 0.648 ms 1 /src/Adapter/EntityMapper.php:79
750 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.648 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
901 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7733) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.647 ms 1 Yes Yes /classes/Product.php:4504
973 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5143) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.646 ms 1 Yes Yes /classes/Product.php:4504
865 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8277) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.645 ms 1 Yes Yes /classes/Product.php:4504
235 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 298)
 0.644 ms 1 /classes/Product.php:3857
838 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2972
ORDER BY `position`
 0.644 ms 1 Yes /classes/Product.php:3545
164 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 292
AND image_shop.`cover` = 1 LIMIT 1
 0.642 ms 1 /classes/Product.php:3570
781 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10992) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.641 ms 1 Yes Yes /classes/Product.php:4504
14 
SELECT SQL_NO_CACHE `name`, `alias` FROM `mangayo_hook_alias`
 0.641 ms 88 /classes/Hook.php:287
505 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7937 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7937 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.636 ms 0 /classes/Cart.php:1410
506 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7937
ORDER BY f.position ASC
 0.634 ms 7 Yes /classes/Product.php:5993
853 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8861) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.633 ms 1 Yes Yes /classes/Product.php:4504
1045 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9171) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.633 ms 1 Yes Yes /classes/Product.php:4504
301 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 304)
 0.623 ms 1 /classes/Product.php:3857
756 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php'
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
 0.616 ms 1 /classes/Smarty/SmartyCustom.php:184
17 
SELECT SQL_NO_CACHE name, alias FROM `mangayo_hook_alias`
 0.615 ms 88 /classes/Hook.php:339
913 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7361) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.612 ms 1 Yes Yes /classes/Product.php:4504
961 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5479) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.610 ms 1 Yes Yes /classes/Product.php:4504
549 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5773 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.609 ms 0 /classes/Cart.php:1410
1092 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 19 AND `id_shop` = 1
 0.609 ms 1 /src/Adapter/EntityMapper.php:79
461 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9135 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.607 ms 0 /classes/Cart.php:1410
877 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.606 ms 1 Yes Yes /classes/Product.php:4504
985 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5139) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.605 ms 1 Yes Yes /classes/Product.php:4504
35 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 90) AND (b.`id_shop` = 1) LIMIT 1
 0.602 ms 1 /src/Adapter/EntityMapper.php:71
484 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8277
ORDER BY f.position ASC
 0.601 ms 7 Yes /classes/Product.php:5993
462 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9135
ORDER BY f.position ASC
 0.601 ms 7 Yes /classes/Product.php:5993
1009 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4094) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.599 ms 1 Yes Yes /classes/Product.php:4504
793 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9503) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.598 ms 1 Yes Yes /classes/Product.php:4504
841 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.597 ms 1 Yes Yes /classes/Product.php:4504
1021 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (404) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.595 ms 1 Yes Yes /classes/Product.php:4504
1033 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9194) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.594 ms 1 Yes Yes /classes/Product.php:4504
604 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4673 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4673 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.594 ms 0 /classes/Cart.php:1410
829 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2972) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.591 ms 1 Yes Yes /classes/Product.php:4504
202 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 295)
 0.590 ms 1 /classes/Product.php:3857
417 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9503 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9503 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.589 ms 0 /classes/Cart.php:1410
560 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5603 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5603 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.589 ms 0 /classes/Cart.php:1410
476 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8277) AND (b.`id_shop` = 1) LIMIT 1
 0.587 ms 1 /src/Adapter/EntityMapper.php:71
949 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5603) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.587 ms 1 Yes Yes /classes/Product.php:4504
937 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.586 ms 1 Yes Yes /classes/Product.php:4504
233 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.584 ms 1 /classes/SpecificPrice.php:259
550 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5773
ORDER BY f.position ASC
 0.584 ms 7 Yes /classes/Product.php:5993
649 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9171 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9171 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.584 ms 0 /classes/Cart.php:1410
406 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10992 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10992 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.583 ms 0 /classes/Cart.php:1410
268 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 301)
 0.583 ms 1 /classes/Product.php:3857
925 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.583 ms 1 Yes Yes /classes/Product.php:4504
527 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7361 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7361 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.582 ms 0 /classes/Cart.php:1410
832 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.582 ms 1 /modules/an_wishlist/classes/an_wish.php:76
410 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9503) AND (b.`id_shop` = 1) LIMIT 1
 0.579 ms 1 /src/Adapter/EntityMapper.php:71
103 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 286)
 0.579 ms 1 /classes/Product.php:3857
428 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7732 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7732 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.579 ms 0 /classes/Cart.php:1410
745 
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
 0.578 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
1087 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) LIMIT 1
 0.578 ms 1 /src/Adapter/EntityMapper.php:71
344 
SELECT SQL_NO_CACHE c.id_category, cl.name, cl.link_rewrite FROM mangayo_category c LEFT JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN mangayo_category_lang cl ON (cl.id_category = c.id_category AND cl.id_shop = 1 )WHERE c.nleft <= 11 AND c.nright >= 28 AND c.nleft >= 2 AND c.nright <= 173 AND cl.id_lang = 1 AND c.level_depth > 1 ORDER BY c.level_depth ASC
 0.578 ms 6 Yes /modules/facebookproductad/lib/moduleTools.php:526
494 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8043 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.578 ms 0 /classes/Cart.php:1410
180 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 293)
 0.577 ms 1 /classes/Product.php:3857
516 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7733 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7733 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.576 ms 0 /classes/Cart.php:1410
0 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM mangayo_shop_url su
LEFT JOIN mangayo_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'mangayo.it' OR su.domain_ssl = 'mangayo.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.575 ms 1 Yes /classes/shop/Shop.php:1364
578 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5143)
 0.574 ms 1 /classes/Product.php:3857
904 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.573 ms 1 /modules/an_wishlist/classes/an_wish.php:76
472 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8861 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8861 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.572 ms 0 /classes/Cart.php:1410
312 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 305)
 0.572 ms 1 /classes/Product.php:3857
421 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7732) AND (b.`id_shop` = 1) LIMIT 1
 0.571 ms 1 /src/Adapter/EntityMapper.php:71
615 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4094 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4094 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.571 ms 0 /classes/Cart.php:1410
92 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 285)
 0.569 ms 1 /classes/Product.php:3857
915 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7361)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.569 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
642 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9171) AND (b.`id_shop` = 1) LIMIT 1
 0.569 ms 1 /src/Adapter/EntityMapper.php:71
660 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7315 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7315 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.569 ms 0 /classes/Cart.php:1410
76 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 284)
 0.567 ms 1 /classes/Product.php:3857
213 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 296)
 0.567 ms 1 /classes/Product.php:3857
246 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 299)
 0.563 ms 1 /classes/Product.php:3857
407 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10992
ORDER BY f.position ASC
 0.562 ms 7 Yes /classes/Product.php:5993
450 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2972 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2972 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.562 ms 0 /classes/Cart.php:1410
70 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE id_product = 0 LIMIT 1
 0.561 ms 1 /classes/SpecificPrice.php:426
158 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 291)
 0.561 ms 1 /classes/Product.php:3857
454 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9135) AND (b.`id_shop` = 1) LIMIT 1
 0.561 ms 1 /src/Adapter/EntityMapper.php:71
582 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5143 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5143 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.561 ms 0 /classes/Cart.php:1410
465 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8861) AND (b.`id_shop` = 1) LIMIT 1
 0.560 ms 1 /src/Adapter/EntityMapper.php:71
169 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 292)
 0.560 ms 1 /classes/Product.php:3857
257 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 300)
 0.559 ms 1 /classes/Product.php:3857
279 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 302)
 0.559 ms 1 /classes/Product.php:3857
432 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6171) AND (b.`id_shop` = 1) LIMIT 1
 0.559 ms 1 /src/Adapter/EntityMapper.php:71
443 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2972) AND (b.`id_shop` = 1) LIMIT 1
 0.558 ms 1 /src/Adapter/EntityMapper.php:71
520 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7361) AND (b.`id_shop` = 1) LIMIT 1
 0.558 ms 1 /src/Adapter/EntityMapper.php:71
597 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4673) AND (b.`id_shop` = 1) LIMIT 1
 0.556 ms 1 /src/Adapter/EntityMapper.php:71
224 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 297)
 0.555 ms 1 /classes/Product.php:3857
571 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5479 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5479 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.555 ms 0 /classes/Cart.php:1410
593 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5139 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.555 ms 0 /classes/Cart.php:1410
689 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5773
ORDER BY `position`
 0.555 ms 1 Yes /classes/Product.php:3545
114 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 287)
 0.554 ms 1 /classes/Product.php:3857
439 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6171 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6171 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.554 ms 0 /classes/Cart.php:1410
638 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9194 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9194 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.553 ms 0 /classes/Cart.php:1410
605 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4673
ORDER BY f.position ASC
 0.553 ms 7 Yes /classes/Product.php:5993
120 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 288
AND image_shop.`cover` = 1 LIMIT 1
 0.552 ms 1 /classes/Product.php:3570
705 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9194
ORDER BY `position`
 0.552 ms 1 Yes /classes/Product.php:3545
732 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php'
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme"
 0.552 ms 1 /classes/Smarty/SmartyCustom.php:184
517 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7733
ORDER BY f.position ASC
 0.550 ms 7 Yes /classes/Product.php:5993
586 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5139) AND (b.`id_shop` = 1) LIMIT 1
 0.550 ms 1 /src/Adapter/EntityMapper.php:71
483 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8277 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8277 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.549 ms 0 /classes/Cart.php:1410
996 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5139
 0.548 ms 1 /classes/Product.php:2902
136 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 289)
 0.548 ms 1 /classes/Product.php:3857
538 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6048 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.548 ms 0 /classes/Cart.php:1410
594 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5139
ORDER BY f.position ASC
 0.548 ms 7 Yes /classes/Product.php:5993
627 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 404 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 404 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.547 ms 0 /classes/Cart.php:1410
575 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5143) AND (b.`id_shop` = 1) LIMIT 1
 0.547 ms 1 /src/Adapter/EntityMapper.php:71
999 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4673)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.546 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
329 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 307
AND image_shop.`cover` = 1 LIMIT 1
 0.545 ms 1 /classes/Product.php:3570
553 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5603) AND (b.`id_shop` = 1) LIMIT 1
 0.545 ms 1 /src/Adapter/EntityMapper.php:71
274 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 302
AND image_shop.`cover` = 1 LIMIT 1
 0.544 ms 1 /classes/Product.php:3570
473 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8861
ORDER BY f.position ASC
 0.544 ms 7 Yes /classes/Product.php:5993
539 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6048
ORDER BY f.position ASC
 0.543 ms 7 Yes /classes/Product.php:5993
1011 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4094)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.542 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
783 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 10992)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.541 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1042 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9194
ORDER BY `position`
 0.541 ms 1 Yes /classes/Product.php:3545
381 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM mangayo_layered_category
WHERE controller = 'category'
AND id_category = 11
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.540 ms 6 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
418 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9503
ORDER BY f.position ASC
 0.540 ms 7 Yes /classes/Product.php:5993
874 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8277
ORDER BY `position`
 0.540 ms 1 Yes /classes/Product.php:3545
388 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
 0.539 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
561 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5603
ORDER BY f.position ASC
 0.539 ms 7 Yes /classes/Product.php:5993
38 
SELECT SQL_NO_CACHE 1 FROM mangayo_cart_product cp INNER JOIN mangayo_product p
ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
 0.539 ms 1 /classes/Cart.php:4192
631 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9194) AND (b.`id_shop` = 1) LIMIT 1
 0.538 ms 1 /src/Adapter/EntityMapper.php:71
191 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 294)
 0.538 ms 1 /classes/Product.php:3857
653 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7315) AND (b.`id_shop` = 1) LIMIT 1
 0.538 ms 1 /src/Adapter/EntityMapper.php:71
891 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7937)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.537 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
440 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6171
ORDER BY f.position ASC
 0.537 ms 7 Yes /classes/Product.php:5993
628 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 404
ORDER BY f.position ASC
 0.536 ms 7 Yes /classes/Product.php:5993
963 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5479)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.536 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
975 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5143)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.536 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
998 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4673
 0.535 ms 3 /classes/Product.php:3423
843 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 9135)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.534 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1059 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7315)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.533 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
807 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7732)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.532 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
495 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8043
ORDER BY f.position ASC
 0.531 ms 7 Yes /classes/Product.php:5993
749 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
 0.530 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
903 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7733)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.530 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
922 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7361
ORDER BY `position`
 0.530 ms 3 Yes /classes/Product.php:3545
886 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8043
ORDER BY `position`
 0.529 ms 3 Yes /classes/Product.php:3545
591 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5139 AND `id_group` = 1 LIMIT 1
 0.529 ms 0 /classes/GroupReduction.php:156
296 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 304
AND image_shop.`cover` = 1 LIMIT 1
 0.528 ms 1 /classes/Product.php:3570
616 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4094
ORDER BY f.position ASC
 0.528 ms 7 Yes /classes/Product.php:5993
153 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 291
AND image_shop.`cover` = 1 LIMIT 1
 0.528 ms 1 /classes/Product.php:3570
1047 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 9171)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.528 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
7 
SELECT SQL_NO_CACHE *
FROM `mangayo_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.526 ms 1 /src/Adapter/EntityMapper.php:71
545 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5773)
 0.526 ms 1 /classes/Product.php:3857
307 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 305
AND image_shop.`cover` = 1 LIMIT 1
 0.525 ms 1 /classes/Product.php:3570
583 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5143
ORDER BY f.position ASC
 0.525 ms 7 Yes /classes/Product.php:5993
831 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 2972)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.525 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
855 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8861)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.525 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
879 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8043)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.525 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
946 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5773
ORDER BY `position`
 0.525 ms 1 Yes /classes/Product.php:3545
66 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 284
AND image_shop.`cover` = 1 LIMIT 1
 0.524 ms 1 /classes/Product.php:3570
939 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5773)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.522 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
867 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8277)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.521 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
285 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 303
AND image_shop.`cover` = 1 LIMIT 1
 0.521 ms 1 /classes/Product.php:3570
197 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 295
AND image_shop.`cover` = 1 LIMIT 1
 0.520 ms 1 /classes/Product.php:3570
1035 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 9194)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.520 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
965 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5479 LIMIT 1
 0.519 ms 4 /modules/an_wishlist/classes/an_wish_products.php:124
131 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 289
AND image_shop.`cover` = 1 LIMIT 1
 0.518 ms 1 /classes/Product.php:3570
263 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 301
AND image_shop.`cover` = 1 LIMIT 1
 0.518 ms 1 /classes/Product.php:3570
11 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `mangayo_lang` l
JOIN mangayo_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.518 ms 1 /classes/Language.php:1216
429 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7732
ORDER BY f.position ASC
 0.518 ms 7 Yes /classes/Product.php:5993
795 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 9503)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.518 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
98 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 286
AND image_shop.`cover` = 1 LIMIT 1
 0.517 ms 1 /classes/Product.php:3570
951 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5603)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.517 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1085 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 16) LIMIT 1
 0.517 ms 1 /src/Adapter/EntityMapper.php:71
6 
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
 0.516 ms 1 /src/Adapter/EntityMapper.php:71
230 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 298
AND image_shop.`cover` = 1 LIMIT 1
 0.513 ms 1 /classes/Product.php:3570
1068 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7315
 0.512 ms 1 /classes/Product.php:2902
252 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 300
AND image_shop.`cover` = 1 LIMIT 1
 0.511 ms 1 /classes/Product.php:3570
451 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2972
ORDER BY f.position ASC
 0.511 ms 7 Yes /classes/Product.php:5993
175 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 293
AND image_shop.`cover` = 1 LIMIT 1
 0.510 ms 1 /classes/Product.php:3570
318 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 306
AND image_shop.`cover` = 1 LIMIT 1
 0.510 ms 1 /classes/Product.php:3570
532 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.510 ms 1 /classes/SpecificPrice.php:259
1023 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 404)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.508 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
528 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7361
ORDER BY f.position ASC
 0.508 ms 7 Yes /classes/Product.php:5993
71 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.507 ms 8769 /classes/SpecificPrice.php:297
639 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9194
ORDER BY f.position ASC
 0.507 ms 14 Yes /classes/Product.php:5993
435 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6171)
 0.506 ms 1 /classes/Product.php:3857
1024 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.506 ms 1 /modules/an_wishlist/classes/an_wish.php:76
186 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 294
AND image_shop.`cover` = 1 LIMIT 1
 0.506 ms 1 /classes/Product.php:3570
109 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 287
AND image_shop.`cover` = 1 LIMIT 1
 0.505 ms 1 /classes/Product.php:3570
572 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5479
ORDER BY f.position ASC
 0.505 ms 7 Yes /classes/Product.php:5993
802 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9503
ORDER BY `position`
 0.505 ms 1 Yes /classes/Product.php:3545
80 
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 211)
AND ('00133' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '00133')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.504 ms 0 /classes/tax/TaxRulesTaxManager.php:109
219 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 297
AND image_shop.`cover` = 1 LIMIT 1
 0.504 ms 1 /classes/Product.php:3570
910 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7733
ORDER BY `position`
 0.504 ms 1 Yes /classes/Product.php:3545
987 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5139)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.504 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1054 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9171
ORDER BY `position`
 0.503 ms 4 Yes /classes/Product.php:3545
826 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6171
ORDER BY `position`
 0.502 ms 1 Yes /classes/Product.php:3545
862 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8861
ORDER BY `position`
 0.502 ms 3 Yes /classes/Product.php:3545
1066 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7315
ORDER BY `position`
 0.502 ms 1 Yes /classes/Product.php:3545
1101 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 15) LIMIT 1
 0.502 ms 1 /src/Adapter/EntityMapper.php:71
1130 
UPDATE `mangayo_page_viewed`
SET `counter` = `counter` + 1
WHERE `id_date_range` = 9307
AND `id_page` = 48
AND `id_shop` = 1
 0.502 ms 1 /classes/Page.php:131
661 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7315
ORDER BY f.position ASC
 0.502 ms 14 Yes /classes/Product.php:5993
321 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.501 ms 1 /classes/SpecificPrice.php:259
241 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 299
AND image_shop.`cover` = 1 LIMIT 1
 0.500 ms 1 /classes/Product.php:3570
934 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6048
ORDER BY `position`
 0.500 ms 1 Yes /classes/Product.php:3545
1030 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 404
ORDER BY `position`
 0.499 ms 1 Yes /classes/Product.php:3545
850 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9135
ORDER BY `position`
 0.498 ms 1 Yes /classes/Product.php:3545
790 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10992
ORDER BY `position`
 0.497 ms 1 Yes /classes/Product.php:3545
814 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7732
ORDER BY `position`
 0.496 ms 1 Yes /classes/Product.php:3545
958 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5603
ORDER BY `position`
 0.495 ms 1 Yes /classes/Product.php:3545
142 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 290
AND image_shop.`cover` = 1 LIMIT 1
 0.495 ms 1 /classes/Product.php:3570
208 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 296
AND image_shop.`cover` = 1 LIMIT 1
 0.495 ms 1 /classes/Product.php:3570
677 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8277
ORDER BY `position`
 0.495 ms 1 Yes /classes/Product.php:3545
994 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5139
ORDER BY `position`
 0.494 ms 1 Yes /classes/Product.php:3545
650 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9171
ORDER BY f.position ASC
 0.492 ms 14 Yes /classes/Product.php:5993
898 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7937
ORDER BY `position`
 0.492 ms 1 Yes /classes/Product.php:3545
1106 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php'
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme"
 0.492 ms 1 /classes/Smarty/SmartyCustom.php:184
288 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.491 ms 1 /classes/SpecificPrice.php:259
600 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4673)
 0.490 ms 1 /classes/Product.php:3857
864 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8861
 0.490 ms 1 /classes/Product.php:2902
49 
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
 0.488 ms 1 /src/Adapter/EntityMapper.php:71
772 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "sociallogin" LIMIT 1
 0.488 ms 1 /classes/module/Module.php:2636
685 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7361
ORDER BY `position`
 0.487 ms 3 Yes /classes/Product.php:3545
1091 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 19) LIMIT 1
 0.487 ms 1 /src/Adapter/EntityMapper.php:71
669 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6171
ORDER BY `position`
 0.486 ms 1 Yes /classes/Product.php:3545
86 
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.485 ms 0 /classes/tax/TaxRulesTaxManager.php:109
936 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6048
 0.482 ms 1 /classes/Product.php:2902
308 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.480 ms 1 /classes/Product.php:5639
24 
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.477 ms 1 /src/Adapter/EntityMapper.php:71
45 
SELECT SQL_NO_CACHE * FROM `mangayo_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.477 ms 18 Yes /classes/ImageType.php:109
468 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8861)
 0.477 ms 1 /classes/Product.php:3857
940 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.477 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1077 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572863))
 0.475 ms 1 /classes/Smarty/SmartyCustom.php:265
422 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7732
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.473 ms 1 /classes/SpecificPrice.php:259
1018 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4094
ORDER BY `position`
 0.473 ms 1 Yes /classes/Product.php:3545
916 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.472 ms 1 /modules/an_wishlist/classes/an_wish.php:76
970 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5479
ORDER BY `position`
 0.472 ms 1 Yes /classes/Product.php:3545
87 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 285
AND image_shop.`cover` = 1 LIMIT 1
 0.471 ms 1 /classes/Product.php:3570
809 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7732 LIMIT 1
 0.471 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
771 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php'
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
 0.470 ms 1 /classes/Smarty/SmartyCustom.php:184
709 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7315
ORDER BY `position`
 0.470 ms 1 Yes /classes/Product.php:3545
20 
SELECT SQL_NO_CACHE * FROM `mangayo_currency` c ORDER BY `iso_code` ASC
 0.469 ms 1 Yes /classes/Currency.php:709
211 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.469 ms 1 /classes/SpecificPrice.php:259
792 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 10992
 0.469 ms 1 /classes/Product.php:2902
1006 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4673
ORDER BY `position`
 0.468 ms 1 Yes /classes/Product.php:3545
413 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9503)
 0.467 ms 1 /classes/Product.php:3857
4 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM mangayo_shop s
LEFT JOIN mangayo_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.466 ms 1 /classes/shop/Shop.php:218
581 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.466 ms 1 /classes/stock/StockAvailable.php:453
707 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9171
ORDER BY `position`
 0.466 ms 4 Yes /classes/Product.php:3545
154 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.465 ms 1 /classes/Product.php:5639
402 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10992)
 0.465 ms 1 /classes/Product.php:3857
1114 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572863))
 0.465 ms 1 /classes/Smarty/SmartyCustom.php:265
1117 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php'
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme"
 0.464 ms 1 /classes/Smarty/SmartyCustom.php:184
662 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10992
ORDER BY `position`
 0.463 ms 1 Yes /classes/Product.php:3545
1128 
INSERT INTO `mangayo_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('7334441', '', 'mangayo.it/11-manga?q=Categoria+-Art+Book-Boys+love-Character+Book-Hentai-Josei-Manhua-Manhwa-Novel-Seinen+-Shoujo-Shoujo%5C-Ai%2FGenere-Ecchi-Harem-Scolastico', '', '2024-06-28 13:07:43')
 0.463 ms 1 /classes/ObjectModel.php:622
982 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5143
ORDER BY `position`
 0.460 ms 1 Yes /classes/Product.php:3545
260 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 300) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.457 ms 1 /classes/stock/StockAvailable.php:453
980 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.457 ms 1 /classes/stock/StockAvailable.php:806
1081 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 1
 0.457 ms 1 /src/Adapter/EntityMapper.php:79
63 
SELECT SQL_NO_CACHE * FROM `mangayo_image_type`
 0.456 ms 18 /classes/ImageType.php:161
1124 
SELECT SQL_NO_CACHE `id_guest`
FROM `mangayo_connections`
WHERE `id_guest` = 7563418
AND `date_add` > '2024-06-28 12:37:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
 0.456 ms 1 Yes /classes/Connection.php:168
1099 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 11) LIMIT 1
 0.454 ms 1 /src/Adapter/EntityMapper.php:71
656 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7315)
 0.454 ms 1 /classes/Product.php:3857
687 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6048
ORDER BY `position`
 0.454 ms 1 Yes /classes/Product.php:3545
764 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
 0.453 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
942 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.451 ms 1 /classes/stock/StockAvailable.php:778
1110 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php'
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme"
 0.451 ms 1 /classes/Smarty/SmartyCustom.php:184
869 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8277 LIMIT 1
 0.450 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
5 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `mangayo_lang` l
LEFT JOIN `mangayo_lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.449 ms 1 /classes/Language.php:1080
567 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5479)
 0.448 ms 1 /classes/Product.php:3857
665 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9503
ORDER BY `position`
 0.448 ms 1 Yes /classes/Product.php:3545
1104 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 23 AND `id_shop` = 1
 0.448 ms 1 /src/Adapter/EntityMapper.php:79
137 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 289 AND id_shop=1 LIMIT 1
 0.447 ms 1 /classes/Product.php:6848
1127 
INSERT IGNORE INTO `mangayo_connections_page` (`id_connections`, `id_page`, `time_start`) VALUES ('7334441', '48', '2024-06-28 13:07:43')
 0.447 ms 1 /classes/Connection.php:122
730 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme" LIMIT 1
 0.446 ms 0 /classes/Smarty/SmartyCustom.php:216
1090 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 1 AND `id_shop` = 1
 0.445 ms 1 /src/Adapter/EntityMapper.php:79
691 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5603
ORDER BY `position`
 0.444 ms 1 Yes /classes/Product.php:3545
225 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 297 AND id_shop=1 LIMIT 1
 0.444 ms 1 /classes/Product.php:6848
924 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7361
 0.444 ms 1 /classes/Product.php:2902
589 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5139)
 0.443 ms 1 /classes/Product.php:3857
679 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8043
ORDER BY `position`
 0.443 ms 3 Yes /classes/Product.php:3545
1115 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572863))
 0.443 ms 1 /classes/Smarty/SmartyCustom.php:265
873 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8277 LIMIT 1
 0.442 ms 1 /classes/Product.php:1106
10 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM mangayo_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.441 ms 1 /classes/shop/ShopUrl.php:182
341 
SELECT SQL_NO_CACHE *
FROM `mangayo_category_lang`
WHERE `id_category` = 11 AND `id_shop` = 1
 0.441 ms 1 /src/Adapter/EntityMapper.php:79
485 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8043
AND image_shop.`cover` = 1 LIMIT 1
 0.441 ms 3 /classes/Product.php:3570
397 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.440 ms 1 /classes/Product.php:5639
731 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('4a4b03e34f9266c4e082efcc7a2e039e',"","charme", FROM_UNIXTIME(1719572862))
 0.440 ms 1 /classes/Smarty/SmartyCustom.php:265
282 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.439 ms 1 /classes/stock/StockAvailable.php:453
64 
SELECT SQL_NO_CACHE id_order
FROM `mangayo_orders` o
WHERE (o.id_cart=0) LIMIT 1
 0.439 ms 1 /modules/facebookproductad/lib/dao/moduleDao.php:383
920 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.438 ms 1 /classes/stock/StockAvailable.php:806
950 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5603
 0.438 ms 3 /classes/Product.php:3423
1079 
SELECT SQL_NO_CACHE lb.`id_link_block`
FROM mangayo_link_block lb
INNER JOIN mangayo_link_block_shop lbs ON lbs.`id_link_block` = lb.`id_link_block`
WHERE lb. `id_hook` = 35 AND lbs.`id_shop` = 1
ORDER by lbs.`position`
 0.438 ms 4 Yes /modules/ps_linklist/src/LegacyLinkBlockRepository.php:87
293 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.437 ms 1 /classes/stock/StockAvailable.php:453
139 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 289) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.436 ms 1 /classes/stock/StockAvailable.php:453
917 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7361 LIMIT 1
 0.436 ms 15 /modules/an_wishlist/classes/an_wish_products.php:124
1108 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme" LIMIT 1
 0.436 ms 1 /classes/Smarty/SmartyCustom.php:216
1109 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('9b994322a10138ad46146161c46d70ed',"","charme", FROM_UNIXTIME(1719572863))
 0.436 ms 1 /classes/Smarty/SmartyCustom.php:265
667 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7732
ORDER BY `position`
 0.435 ms 1 Yes /classes/Product.php:3545
551 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5603
AND image_shop.`cover` = 1 LIMIT 1
 0.434 ms 1 /classes/Product.php:3570
167 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 292
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.433 ms 1 /classes/SpecificPrice.php:259
1086 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 16 AND `id_shop` = 1
 0.433 ms 1 /src/Adapter/EntityMapper.php:79
200 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.432 ms 1 /classes/SpecificPrice.php:259
697 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5139
ORDER BY `position`
 0.432 ms 1 Yes /classes/Product.php:3545
794 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 9503
 0.432 ms 3 /classes/Product.php:3423
340 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) LIMIT 1
 0.431 ms 1 /src/Adapter/EntityMapper.php:71
490 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8043)
 0.431 ms 1 /classes/Product.php:3857
562 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5479
AND image_shop.`cover` = 1 LIMIT 1
 0.431 ms 1 /classes/Product.php:3570
1122 
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_widgets` sw
LEFT JOIN `mangayo_an_trust_badges_widgets_lang` sl 
ON (sw.`id_widget` = sl.`id_widget`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1 
AND sw.`hook`="displayCopyrightContainer"
 0.431 ms 2 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php:86
523 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7361)
 0.430 ms 1 /classes/Product.php:3857
446 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2972)
 0.430 ms 1 /classes/Product.php:3857
115 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 287 AND id_shop=1 LIMIT 1
 0.429 ms 1 /classes/Product.php:6848
424 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7732)
 0.429 ms 1 /classes/Product.php:3857
675 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8861
ORDER BY `position`
 0.429 ms 3 Yes /classes/Product.php:3545
441 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2972
AND image_shop.`cover` = 1 LIMIT 1
 0.428 ms 1 /classes/Product.php:3570
280 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 302 AND id_shop=1 LIMIT 1
 0.428 ms 1 /classes/Product.php:6848
330 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.428 ms 1 /classes/Product.php:5639
457 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9135)
 0.428 ms 1 /classes/Product.php:3857
806 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7732
 0.428 ms 3 /classes/Product.php:3423
868 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.428 ms 1 /modules/an_wishlist/classes/an_wish.php:76
921 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7361 LIMIT 1
 0.428 ms 1 /classes/Product.php:1106
1041 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 9194 LIMIT 1
 0.428 ms 1 /classes/Product.php:1106
187 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.427 ms 1 /classes/Product.php:5639
379 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 2 LIMIT 1
 0.427 ms 0 /classes/Category.php:1375
671 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2972
ORDER BY `position`
 0.427 ms 1 Yes /classes/Product.php:3545
673 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9135
ORDER BY `position`
 0.427 ms 1 Yes /classes/Product.php:3545
743 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572862))
 0.426 ms 1 /classes/Smarty/SmartyCustom.php:265
1060 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.426 ms 1 /modules/an_wishlist/classes/an_wish.php:76
26 
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.425 ms 1 /src/Adapter/EntityMapper.php:71
479 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8277)
 0.425 ms 1 /classes/Product.php:3857
31 
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.424 ms 1 /classes/ObjectModel.php:1729
1013 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4094 LIMIT 1
 0.424 ms 63 /modules/an_wishlist/classes/an_wish_products.php:124
22 
SELECT SQL_NO_CACHE value FROM `mangayo_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.423 ms 1 /classes/shop/Shop.php:1183
99 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.423 ms 1 /classes/Product.php:5639
104 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 286 AND id_shop=1 LIMIT 1
 0.423 ms 1 /classes/Product.php:6848
634 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9194)
 0.423 ms 1 /classes/Product.php:3857
695 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5143
ORDER BY `position`
 0.423 ms 1 Yes /classes/Product.php:3545
894 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.423 ms 1 /classes/stock/StockAvailable.php:778
1015 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.423 ms 1 /classes/stock/StockAvailable.php:753
3 
SELECT SQL_NO_CACHE *
FROM `mangayo_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.422 ms 1 /src/Adapter/EntityMapper.php:71
25 
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
 0.422 ms 1 /classes/Language.php:883
29 
SELECT SQL_NO_CACHE *
FROM `mangayo_group` a
LEFT JOIN `mangayo_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.422 ms 1 /src/Adapter/EntityMapper.php:71
77 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 284 AND id_shop=1 LIMIT 1
 0.422 ms 1 /classes/Product.php:6848
189 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 294
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.422 ms 1 /classes/SpecificPrice.php:259
275 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.422 ms 1 /classes/Product.php:5639
681 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7937
ORDER BY `position`
 0.422 ms 1 Yes /classes/Product.php:3545
729 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='template' LIMIT 1
 0.421 ms 1 /classes/Smarty/SmartyCustom.php:143
976 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.421 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1029 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 404 LIMIT 1
 0.421 ms 1 /classes/Product.php:1106
1123 
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_icons` sw
WHERE sw.`active`=1
 0.421 ms 40 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php:84
641 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.421 ms 1 /classes/Product.php:5639
852 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9135
 0.421 ms 1 /classes/Product.php:2902
110 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.420 ms 1 /classes/Product.php:5639
253 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.420 ms 1 /classes/Product.php:5639
319 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.420 ms 1 /classes/Product.php:5639
611 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4094)
 0.420 ms 1 /classes/Product.php:3857
355 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.419 ms 0 /classes/module/Module.php:2109
90 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.418 ms 1 /classes/SpecificPrice.php:259
291 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 303 AND id_shop=1 LIMIT 1
 0.418 ms 1 /classes/Product.php:6848
345 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
 0.418 ms 0 /classes/module/Module.php:2636
789 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 10992 LIMIT 1
 0.418 ms 1 /classes/Product.php:1106
964 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.418 ms 1 /modules/an_wishlist/classes/an_wish.php:76
9 
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
 0.417 ms 1 /classes/ObjectModel.php:1729
408 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9503
AND image_shop.`cover` = 1 LIMIT 1
 0.417 ms 1 /classes/Product.php:3570
683 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7733
ORDER BY `position`
 0.417 ms 1 Yes /classes/Product.php:3545
713 
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
 0.417 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
818 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6171
 0.417 ms 3 /classes/Product.php:3423
83 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.416 ms 1 /classes/stock/StockAvailable.php:453
825 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6171 LIMIT 1
 0.416 ms 1 /classes/Product.php:1106
121 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.415 ms 1 /classes/Product.php:5639
822 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.415 ms 1 /classes/stock/StockAvailable.php:778
978 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.415 ms 1 /classes/stock/StockAvailable.php:778
236 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 298 AND id_shop=1 LIMIT 1
 0.415 ms 1 /classes/Product.php:6848
534 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6048)
 0.414 ms 1 /classes/Product.php:3857
703 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 404
ORDER BY `position`
 0.414 ms 1 Yes /classes/Product.php:3545
198 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.413 ms 1 /classes/Product.php:5639
203 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 295 AND id_shop=1 LIMIT 1
 0.413 ms 1 /classes/Product.php:6848
512 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7733)
 0.413 ms 1 /classes/Product.php:3857
60 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='compile' LIMIT 1
 0.412 ms 1 /classes/Smarty/SmartyCustom.php:96
737 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.412 ms 1 /modules/an_wishlist/classes/an_wish.php:76
813 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7732 LIMIT 1
 0.412 ms 1 /classes/Product.php:1106
8 
SELECT SQL_NO_CACHE *
FROM `mangayo_lang` a
LEFT JOIN `mangayo_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
 0.411 ms 1 /src/Adapter/EntityMapper.php:71
67 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 11 LIMIT 1
 0.411 ms 1 /classes/Category.php:1375
205 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.411 ms 1 /classes/stock/StockAvailable.php:453
346 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 14 LIMIT 1
 0.411 ms 1 /classes/Hook.php:244
1069 
SELECT SQL_NO_CACHE *
FROM `mangayo_image_type` a
WHERE (a.`id_image_type` = 14) LIMIT 1
 0.411 ms 1 /src/Adapter/EntityMapper.php:71
801 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 9503 LIMIT 1
 0.410 ms 1 /classes/Product.php:1106
977 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5143 LIMIT 1
 0.410 ms 6 /modules/an_wishlist/classes/an_wish_products.php:124
810 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7732) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.409 ms 1 /classes/stock/StockAvailable.php:778
304 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.409 ms 1 /classes/stock/StockAvailable.php:453
573 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5143
AND image_shop.`cover` = 1 LIMIT 1
 0.409 ms 1 /classes/Product.php:3570
816 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7732
 0.409 ms 1 /classes/Product.php:2902
849 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 9135 LIMIT 1
 0.409 ms 1 /classes/Product.php:1106
315 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.408 ms 1 /classes/stock/StockAvailable.php:453
348 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_searchbar" LIMIT 1
 0.408 ms 1 /classes/module/Module.php:2636
663 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 10992
 0.408 ms 1 /classes/Product.php:2902
933 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6048 LIMIT 1
 0.408 ms 1 /classes/Product.php:1106
50 
SELECT SQL_NO_CACHE *
FROM `mangayo_country_lang`
WHERE `id_country` = 10
 0.407 ms 1 /src/Adapter/EntityMapper.php:79
101 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.407 ms 1 /classes/SpecificPrice.php:259
220 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.407 ms 1 /classes/Product.php:5639
699 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4673
ORDER BY `position`
 0.407 ms 1 Yes /classes/Product.php:3545
1025 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 404 LIMIT 1
 0.407 ms 50 /modules/an_wishlist/classes/an_wish_products.php:124
27 
SELECT SQL_NO_CACHE *
FROM `mangayo_currency_lang`
WHERE `id_currency` = 1
 0.406 ms 1 /src/Adapter/EntityMapper.php:79
651 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7315
AND image_shop.`cover` = 1 LIMIT 1
 0.406 ms 1 /classes/Product.php:3570
701 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4094
ORDER BY `position`
 0.406 ms 1 Yes /classes/Product.php:3545
143 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.404 ms 1 /classes/Product.php:5639
238 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.404 ms 1 /classes/stock/StockAvailable.php:453
918 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.404 ms 1 /classes/stock/StockAvailable.php:778
88 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.404 ms 1 /classes/Product.php:5639
148 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 290 AND id_shop=1 LIMIT 1
 0.404 ms 1 /classes/Product.php:6848
375 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "payplug" LIMIT 1
 0.404 ms 1 /classes/module/Module.php:2636
909 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7733 LIMIT 1
 0.403 ms 1 /classes/Product.php:1106
1005 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4673 LIMIT 1
 0.403 ms 1 /classes/Product.php:1106
501 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7937)
 0.403 ms 1 /classes/Product.php:3857
758 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572862))
 0.402 ms 1 /classes/Smarty/SmartyCustom.php:265
178 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.402 ms 1 /classes/SpecificPrice.php:259
204 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 295 AND `id_group` = 1 LIMIT 1
 0.402 ms 0 /classes/GroupReduction.php:156
313 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 305 AND id_shop=1 LIMIT 1
 0.402 ms 1 /classes/Product.php:6848
784 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.402 ms 1 /modules/an_wishlist/classes/an_wish.php:76
821 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6171 LIMIT 1
 0.402 ms 2 /modules/an_wishlist/classes/an_wish_products.php:124
981 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5143 LIMIT 1
 0.402 ms 1 /classes/Product.php:1106
324 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 306 AND id_shop=1 LIMIT 1
 0.401 ms 1 /classes/Product.php:6848
584 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5139
AND image_shop.`cover` = 1 LIMIT 1
 0.401 ms 1 /classes/Product.php:3570
693 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5479
ORDER BY `position`
 0.401 ms 1 Yes /classes/Product.php:3545
1022 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 404
 0.401 ms 2 /classes/Product.php:3423
928 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.400 ms 1 /modules/an_wishlist/classes/an_wish.php:76
993 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5139 LIMIT 1
 0.400 ms 1 /classes/Product.php:1106
332 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.400 ms 1 /classes/SpecificPrice.php:259
556 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5603)
 0.400 ms 1 /classes/Product.php:3857
837 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 2972 LIMIT 1
 0.400 ms 1 /classes/Product.php:1106
117 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.399 ms 1 /classes/stock/StockAvailable.php:453
833 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 2972 LIMIT 1
 0.399 ms 13 /modules/an_wishlist/classes/an_wish_products.php:124
952 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.399 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1056 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9171
 0.399 ms 1 /classes/Product.php:2902
1064 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.399 ms 1 /classes/stock/StockAvailable.php:806
165 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.399 ms 1 /classes/Product.php:5639
277 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.399 ms 1 /classes/SpecificPrice.php:259
496 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7937
AND image_shop.`cover` = 1 LIMIT 1
 0.399 ms 1 /classes/Product.php:3570
231 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.398 ms 1 /classes/Product.php:5639
255 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 300
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.398 ms 1 /classes/SpecificPrice.php:259
623 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 404)
 0.397 ms 1 /classes/Product.php:3857
1048 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.397 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1071 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_contactinfo" LIMIT 1
 0.397 ms 1 /classes/module/Module.php:2636
149 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 290 AND `id_group` = 1 LIMIT 1
 0.396 ms 0 /classes/GroupReduction.php:156
249 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.396 ms 1 /classes/stock/StockAvailable.php:453
326 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.396 ms 1 /classes/stock/StockAvailable.php:453
396 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10992
AND image_shop.`cover` = 1 LIMIT 1
 0.396 ms 1 /classes/Product.php:3570
808 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.396 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1034 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 9194
 0.396 ms 3 /classes/Product.php:3423
95 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.395 ms 1 /classes/stock/StockAvailable.php:453
299 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.395 ms 1 /classes/SpecificPrice.php:259
430 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6171
AND image_shop.`cover` = 1 LIMIT 1
 0.395 ms 1 /classes/Product.php:3570
617 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 404
AND image_shop.`cover` = 1 LIMIT 1
 0.395 ms 1 /classes/Product.php:3570
960 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5603
 0.395 ms 1 /classes/Product.php:2902
988 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.395 ms 1 /modules/an_wishlist/classes/an_wish.php:76
123 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 288
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.395 ms 1 /classes/SpecificPrice.php:259
774 
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
 0.395 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
72 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `from` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
 0.394 ms 1 /classes/SpecificPrice.php:377
845 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 9135 LIMIT 1
 0.394 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
51 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM mangayo_required_field
 0.394 ms 1 /classes/ObjectModel.php:1592
419 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7732
AND image_shop.`cover` = 1 LIMIT 1
 0.394 ms 1 /classes/Product.php:3570
858 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.394 ms 1 /classes/stock/StockAvailable.php:778
474 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8277
AND image_shop.`cover` = 1 LIMIT 1
 0.393 ms 1 /classes/Product.php:3570
595 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4673
AND image_shop.`cover` = 1 LIMIT 1
 0.393 ms 1 /classes/Product.php:3570
645 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9171)
 0.393 ms 1 /classes/Product.php:3857
840 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2972
 0.393 ms 1 /classes/Product.php:2902
36 
SELECT SQL_NO_CACHE * FROM `mangayo_hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.392 ms 1 /classes/module/Module.php:2018
1014 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.392 ms 1 /classes/stock/StockAvailable.php:778
1126 
SELECT SQL_NO_CACHE `id_page`
FROM `mangayo_page`
WHERE `id_page_type` = 7 AND `id_object` = 11 LIMIT 1
 0.392 ms 1 /classes/Page.php:83
463 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8861
AND image_shop.`cover` = 1 LIMIT 1
 0.392 ms 3 /classes/Product.php:3570
811 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7732) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.392 ms 1 /classes/stock/StockAvailable.php:753
128 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 288) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.391 ms 1 /classes/stock/StockAvailable.php:453
310 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.391 ms 1 /classes/SpecificPrice.php:259
449 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 2972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.391 ms 1 /classes/stock/StockAvailable.php:453
738 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_shoppingcart" LIMIT 1
 0.391 ms 1 /classes/module/Module.php:2636
782 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 10992
 0.391 ms 3 /classes/Product.php:3423
1074 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_linklist" LIMIT 1
 0.391 ms 1 /classes/module/Module.php:2636
820 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.391 ms 1 /modules/an_wishlist/classes/an_wish.php:76
23 
SELECT SQL_NO_CACHE c.id_currency
FROM `mangayo_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.390 ms 1 /classes/Currency.php:893
172 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.390 ms 1 /classes/stock/StockAvailable.php:453
541 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.390 ms 1 /classes/Product.php:5639
640 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9171
AND image_shop.`cover` = 1 LIMIT 1
 0.390 ms 4 /classes/Product.php:3570
974 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5143
 0.390 ms 3 /classes/Product.php:3423
880 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.390 ms 1 /modules/an_wishlist/classes/an_wish.php:76
214 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 296 AND id_shop=1 LIMIT 1
 0.389 ms 1 /classes/Product.php:6848
244 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.389 ms 1 /classes/SpecificPrice.php:259
779 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_productattributes" LIMIT 1
 0.389 ms 1 /classes/module/Module.php:2636
1062 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.389 ms 1 /classes/stock/StockAvailable.php:778
694 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5479
 0.388 ms 1 /classes/Product.php:2902
1125 
SELECT SQL_NO_CACHE id_page_type
FROM mangayo_page_type
WHERE name = 'category' LIMIT 1
 0.388 ms 1 /classes/Page.php:104
335 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 307 AND id_shop=1 LIMIT 1
 0.388 ms 1 /classes/Product.php:6848
48 
SELECT SQL_NO_CACHE *
FROM `mangayo_state` a
WHERE (a.`id_state` = 211) LIMIT 1
 0.387 ms 1 /src/Adapter/EntityMapper.php:71
132 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.387 ms 1 /classes/Product.php:5639
286 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.387 ms 1 /classes/Product.php:5639
885 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8043 LIMIT 1
 0.387 ms 1 /classes/Product.php:1106
1001 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4673 LIMIT 1
 0.387 ms 31 /modules/an_wishlist/classes/an_wish_products.php:124
1058 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7315
 0.387 ms 3 /classes/Product.php:3423
44 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.386 ms 0 /classes/module/Module.php:2109
56 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_productcomments" LIMIT 1
 0.386 ms 0 /classes/module/Module.php:2636
61 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedpack" LIMIT 1
 0.386 ms 0 /classes/module/Module.php:2636
373 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.386 ms 0 /classes/module/Module.php:2109
540 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5773
AND image_shop.`cover` = 1 LIMIT 1
 0.386 ms 1 /classes/Product.php:3570
629 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9194
AND image_shop.`cover` = 1 LIMIT 1
 0.386 ms 1 /classes/Product.php:3570
773 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1
 0.386 ms 1 /classes/module/Module.php:2109
150 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 290) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.385 ms 1 /classes/stock/StockAvailable.php:453
507 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7733
AND image_shop.`cover` = 1 LIMIT 1
 0.385 ms 1 /classes/Product.php:3570
861 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8861 LIMIT 1
 0.385 ms 1 /classes/Product.php:1106
1065 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7315 LIMIT 1
 0.385 ms 1 /classes/Product.php:1106
32 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM mangayo_category_group ctg
WHERE ctg.`id_category` = 11 AND ctg.`id_group` = 1 LIMIT 1
 0.385 ms 1 /classes/Category.php:1751
82 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_group`
WHERE `id_group` = 1 LIMIT 1
 0.384 ms 1 /classes/Group.php:154
209 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.384 ms 1 /classes/Product.php:5639
796 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.384 ms 1 /modules/an_wishlist/classes/an_wish.php:76
343 
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 2) LIMIT 1
 0.384 ms 1 /classes/Category.php:1971
362 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tvcmssearch" LIMIT 1
 0.384 ms 0 /classes/module/Module.php:2636
1061 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7315 LIMIT 1
 0.384 ms 61 /modules/an_wishlist/classes/an_wish_products.php:124
30 
SELECT SQL_NO_CACHE *
FROM `mangayo_group_lang`
WHERE `id_group` = 1
 0.383 ms 1 /src/Adapter/EntityMapper.php:79
216 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.383 ms 1 /classes/stock/StockAvailable.php:453
497 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.383 ms 1 /classes/Product.php:5639
890 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7937
 0.383 ms 3 /classes/Product.php:3423
138 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 289 AND `id_group` = 1 LIMIT 1
 0.383 ms 0 /classes/GroupReduction.php:156
606 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4094
AND image_shop.`cover` = 1 LIMIT 1
 0.383 ms 1 /classes/Product.php:3570
736 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
 0.383 ms 1 /classes/module/Module.php:2109
844 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.383 ms 1 /modules/an_wishlist/classes/an_wish.php:76
906 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.383 ms 1 /classes/stock/StockAvailable.php:778
74 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.382 ms 1 /classes/SpecificPrice.php:259
452 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9135
AND image_shop.`cover` = 1 LIMIT 1
 0.382 ms 1 /classes/Product.php:3570
967 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.382 ms 1 /classes/stock/StockAvailable.php:753
156 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 291
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.381 ms 1 /classes/SpecificPrice.php:259
176 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.381 ms 1 /classes/Product.php:5639
504 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.381 ms 1 /classes/stock/StockAvailable.php:453
1017 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4094 LIMIT 1
 0.381 ms 1 /classes/Product.php:1106
297 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.380 ms 1 /classes/Product.php:5639
325 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 306 AND `id_group` = 1 LIMIT 1
 0.380 ms 0 /classes/GroupReduction.php:156
518 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7361
AND image_shop.`cover` = 1 LIMIT 1
 0.380 ms 3 /classes/Product.php:3570
948 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5773
 0.380 ms 1 /classes/Product.php:2902
777 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 10 AND `id_shop` = 1 LIMIT 1
 0.380 ms 1 /classes/module/Module.php:2109
53 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_homecategories" LIMIT 1
 0.379 ms 0 /classes/module/Module.php:2636
227 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.379 ms 1 /classes/stock/StockAvailable.php:453
785 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 10992 LIMIT 1
 0.379 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
876 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8277
 0.379 ms 1 /classes/Product.php:2902
878 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8043
 0.379 ms 3 /classes/Product.php:3423
897 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7937 LIMIT 1
 0.379 ms 1 /classes/Product.php:1106
337 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.379 ms 1 /classes/stock/StockAvailable.php:453
603 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.379 ms 1 /classes/stock/StockAvailable.php:453
776 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_categorytree" LIMIT 1
 0.379 ms 1 /classes/module/Module.php:2636
930 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.379 ms 1 /classes/stock/StockAvailable.php:778
1010 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4094
 0.379 ms 2 /classes/Product.php:3423
106 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.378 ms 1 /classes/stock/StockAvailable.php:453
563 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.378 ms 1 /classes/Product.php:5639
969 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5479 LIMIT 1
 0.378 ms 1 /classes/Product.php:1106
1102 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 15 AND `id_shop` = 1
 0.378 ms 1 /src/Adapter/EntityMapper.php:79
742 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.377 ms 0 /classes/Smarty/SmartyCustom.php:216
55 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 142 AND `id_shop` = 1 LIMIT 1
 0.377 ms 0 /classes/module/Module.php:2109
292 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 303 AND `id_group` = 1 LIMIT 1
 0.377 ms 0 /classes/GroupReduction.php:156
529 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6048
AND image_shop.`cover` = 1 LIMIT 1
 0.377 ms 1 /classes/Product.php:3570
664 
SELECT SQL_NO_CACHE state FROM mangayo_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.377 ms 1 /classes/FeatureFlag.php:105
962 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5479
 0.377 ms 3 /classes/Product.php:3423
1093 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 8) LIMIT 1
 0.377 ms 1 /src/Adapter/EntityMapper.php:71
1120 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_trust_badges" LIMIT 1
 0.377 ms 1 /classes/module/Module.php:2636
183 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.376 ms 1 /classes/stock/StockAvailable.php:453
193 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 294 AND `id_group` = 1 LIMIT 1
 0.376 ms 0 /classes/GroupReduction.php:156
271 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 301) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.376 ms 1 /classes/stock/StockAvailable.php:453
486 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.376 ms 1 /classes/Product.php:5639
554 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5603
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.376 ms 1 /classes/SpecificPrice.php:259
834 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.376 ms 1 /classes/stock/StockAvailable.php:778
883 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.376 ms 1 /classes/stock/StockAvailable.php:753
944 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.376 ms 1 /classes/stock/StockAvailable.php:806
1008 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4673
 0.376 ms 1 /classes/Product.php:2902
1050 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.376 ms 1 /classes/stock/StockAvailable.php:778
127 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 288 AND `id_group` = 1 LIMIT 1
 0.375 ms 0 /classes/GroupReduction.php:156
134 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 289
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.375 ms 1 /classes/SpecificPrice.php:259
145 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 290
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.375 ms 1 /classes/SpecificPrice.php:259
722 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `mangayo_currency` c
LEFT JOIN mangayo_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.375 ms 1 /classes/Currency.php:1136
1098 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 10 AND `id_shop` = 1
 0.375 ms 1 /src/Adapter/EntityMapper.php:79
62 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "btfacebookchats" LIMIT 1
 0.375 ms 0 /classes/module/Module.php:2636
502 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7937 AND id_shop=1 LIMIT 1
 0.375 ms 1 /classes/Product.php:6848
1095 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 9) LIMIT 1
 0.375 ms 1 /src/Adapter/EntityMapper.php:71
380 
SELECT SQL_NO_CACHE e.`id_product` as id
FROM `mangayo_product` e
WHERE (e.`id_product` = 12211) LIMIT 1
 0.374 ms 1 /classes/ObjectModel.php:2029
438 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.374 ms 1 /classes/stock/StockAvailable.php:453
755 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572862))
 0.374 ms 1 /classes/Smarty/SmartyCustom.php:265
1131 
SELECT SQL_NO_CACHE data
FROM `mangayo_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
 0.374 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
181 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 293 AND id_shop=1 LIMIT 1
 0.374 ms 1 /classes/Product.php:6848
359 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.374 ms 0 /classes/module/Module.php:2109
896 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.374 ms 1 /classes/stock/StockAvailable.php:806
984 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5143
 0.373 ms 1 /classes/Product.php:2902
1026 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 404) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.373 ms 1 /classes/stock/StockAvailable.php:778
314 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 305 AND `id_group` = 1 LIMIT 1
 0.372 ms 0 /classes/GroupReduction.php:156
842 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 9135
 0.372 ms 3 /classes/Product.php:3423
21 
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
 0.372 ms 1 /classes/Language.php:883
302 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 304 AND id_shop=1 LIMIT 1
 0.372 ms 1 /classes/Product.php:6848
700 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4673
 0.372 ms 1 /classes/Product.php:2902
830 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 2972
 0.372 ms 3 /classes/Product.php:3423
905 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7733 LIMIT 1
 0.372 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
953 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5603 LIMIT 1
 0.372 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
1097 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 10) LIMIT 1
 0.372 ms 1 /src/Adapter/EntityMapper.php:71
336 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 307 AND `id_group` = 1 LIMIT 1
 0.371 ms 0 /classes/GroupReduction.php:156
482 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.371 ms 1 /classes/stock/StockAvailable.php:453
727 
SELECT SQL_NO_CACHE *
FROM `mangayo_dark_mode` a
WHERE (a.`id` = 1) LIMIT 1
 0.371 ms 1 /src/Adapter/EntityMapper.php:71
892 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.371 ms 1 /modules/an_wishlist/classes/an_wish.php:76
991 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.371 ms 1 /classes/stock/StockAvailable.php:753
1000 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.371 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1076 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.371 ms 0 /classes/Smarty/SmartyCustom.php:216
28 
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
 0.370 ms 1 /classes/ObjectModel.php:1729
824 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.370 ms 1 /classes/stock/StockAvailable.php:806
881 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8043 LIMIT 1
 0.370 ms 10 /modules/an_wishlist/classes/an_wish_products.php:124
1003 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.370 ms 1 /classes/stock/StockAvailable.php:753
1053 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 9171 LIMIT 1
 0.370 ms 1 /classes/Product.php:1106
170 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 292 AND id_shop=1 LIMIT 1
 0.369 ms 1 /classes/Product.php:6848
938 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5773
 0.369 ms 3 /classes/Product.php:3423
112 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.369 ms 1 /classes/SpecificPrice.php:259
171 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 292 AND `id_group` = 1 LIMIT 1
 0.369 ms 0 /classes/GroupReduction.php:156
914 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7361
 0.369 ms 3 /classes/Product.php:3423
194 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 294) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.368 ms 1 /classes/stock/StockAvailable.php:453
242 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.368 ms 1 /classes/Product.php:5639
871 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.368 ms 1 /classes/stock/StockAvailable.php:753
1083 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 6
 0.368 ms 1 /src/Adapter/EntityMapper.php:79
1118 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_copyright" LIMIT 1
 0.368 ms 1 /classes/module/Module.php:2636
926 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6048
 0.368 ms 3 /classes/Product.php:3423
1036 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.368 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1089 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 1) LIMIT 1
 0.368 ms 1 /src/Adapter/EntityMapper.php:71
161 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 291) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.367 ms 1 /classes/stock/StockAvailable.php:453
363 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.367 ms 0 /classes/module/Module.php:2109
364 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "stsearchbar" LIMIT 1
 0.367 ms 0 /classes/module/Module.php:2636
1037 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 9194 LIMIT 1
 0.367 ms 29 /modules/an_wishlist/classes/an_wish_products.php:124
73 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `to` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
 0.367 ms 1 /classes/SpecificPrice.php:381
258 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 300 AND id_shop=1 LIMIT 1
 0.367 ms 1 /classes/Product.php:6848
264 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.367 ms 1 /classes/Product.php:5639
266 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 301
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.367 ms 1 /classes/SpecificPrice.php:259
798 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9503) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.367 ms 1 /classes/stock/StockAvailable.php:778
902 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7733
 0.367 ms 3 /classes/Product.php:3423
1038 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.367 ms 1 /classes/stock/StockAvailable.php:778
270 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 301 AND `id_group` = 1 LIMIT 1
 0.366 ms 0 /classes/GroupReduction.php:156
46 
SELECT SQL_NO_CACHE format
FROM `mangayo_address_format`
WHERE `id_country` = 10 LIMIT 1
 0.365 ms 1 /classes/AddressFormat.php:656
269 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 301 AND id_shop=1 LIMIT 1
 0.365 ms 1 /classes/Product.php:6848
989 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5139 LIMIT 1
 0.365 ms 19 /modules/an_wishlist/classes/an_wish_products.php:124
1080 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 1) LIMIT 1
 0.365 ms 1 /src/Adapter/EntityMapper.php:71
248 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 299 AND `id_group` = 1 LIMIT 1
 0.365 ms 0 /classes/GroupReduction.php:156
929 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6048 LIMIT 1
 0.364 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
1072 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 12 AND `id_shop` = 1 LIMIT 1
 0.364 ms 1 /classes/module/Module.php:2109
1082 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 6) LIMIT 1
 0.364 ms 1 /src/Adapter/EntityMapper.php:71
786 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 10992) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.364 ms 1 /classes/stock/StockAvailable.php:778
81 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 284 AND `id_group` = 1 LIMIT 1
 0.363 ms 0 /classes/GroupReduction.php:156
350 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "leoproductsearch" LIMIT 1
 0.363 ms 0 /classes/module/Module.php:2636
882 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.363 ms 1 /classes/stock/StockAvailable.php:778
968 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.363 ms 1 /classes/stock/StockAvailable.php:806
637 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 9194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.363 ms 1 /classes/stock/StockAvailable.php:453
780 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.363 ms 1 /classes/module/Module.php:2109
854 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8861
 0.363 ms 3 /classes/Product.php:3423
342 
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 11) LIMIT 1
 0.362 ms 1 /classes/Category.php:1971
912 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7733
 0.362 ms 1 /classes/Product.php:2902
580 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5143 AND `id_group` = 1 LIMIT 1
 0.362 ms 0 /classes/GroupReduction.php:156
857 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8861 LIMIT 1
 0.362 ms 8 /modules/an_wishlist/classes/an_wish_products.php:124
1049 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 9171 LIMIT 1
 0.362 ms 51 /modules/an_wishlist/classes/an_wish_products.php:124
1103 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 23) LIMIT 1
 0.362 ms 1 /src/Adapter/EntityMapper.php:71
247 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 299 AND id_shop=1 LIMIT 1
 0.361 ms 1 /classes/Product.php:6848
848 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.361 ms 1 /classes/stock/StockAvailable.php:806
860 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.361 ms 1 /classes/stock/StockAvailable.php:806
116 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 287 AND `id_group` = 1 LIMIT 1
 0.360 ms 0 /classes/GroupReduction.php:156
614 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.360 ms 1 /classes/stock/StockAvailable.php:453
686 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7361
 0.360 ms 1 /classes/Product.php:2902
1084 
SELECT SQL_NO_CACHE *
FROM `mangayo_hook` a
WHERE (a.`id_hook` = 35) LIMIT 1
 0.360 ms 1 /src/Adapter/EntityMapper.php:71
870 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.360 ms 1 /classes/stock/StockAvailable.php:778
368 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "bonsearch" LIMIT 1
 0.359 ms 0 /classes/module/Module.php:2636
759 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572862))
 0.359 ms 1 /classes/Smarty/SmartyCustom.php:265
823 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.359 ms 1 /classes/stock/StockAvailable.php:753
931 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.359 ms 1 /classes/stock/StockAvailable.php:753
954 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.359 ms 1 /classes/stock/StockAvailable.php:778
979 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.359 ms 1 /classes/stock/StockAvailable.php:753
1012 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.359 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1111 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customeraccountlinks" LIMIT 1
 0.359 ms 1 /classes/module/Module.php:2636
372 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "spsearchpro" LIMIT 1
 0.359 ms 0 /classes/module/Module.php:2636
866 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8277
 0.359 ms 3 /classes/Product.php:3423
222 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.358 ms 1 /classes/SpecificPrice.php:259
237 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 298 AND `id_group` = 1 LIMIT 1
 0.358 ms 0 /classes/GroupReduction.php:156
481 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8277 AND `id_group` = 1 LIMIT 1
 0.358 ms 0 /classes/GroupReduction.php:156
492 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8043 AND `id_group` = 1 LIMIT 1
 0.358 ms 0 /classes/GroupReduction.php:156
770 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572862))
 0.358 ms 1 /classes/Smarty/SmartyCustom.php:265
94 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 285 AND `id_group` = 1 LIMIT 1
 0.358 ms 0 /classes/GroupReduction.php:156
425 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7732 AND id_shop=1 LIMIT 1
 0.358 ms 1 /classes/Product.php:6848
846 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.358 ms 1 /classes/stock/StockAvailable.php:778
1075 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
 0.357 ms 1 /classes/module/Module.php:2109
420 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.357 ms 1 /classes/Product.php:5639
888 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8043
 0.357 ms 1 /classes/Product.php:2902
907 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.357 ms 1 /classes/stock/StockAvailable.php:753
1046 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 9171
 0.357 ms 3 /classes/Product.php:3423
1113 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.357 ms 0 /classes/Smarty/SmartyCustom.php:216
399 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 5
AND `active` = 1 LIMIT 1
 0.356 ms 1 /classes/Manufacturer.php:316
159 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 291 AND id_shop=1 LIMIT 1
 0.356 ms 1 /classes/Product.php:6848
367 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.356 ms 0 /classes/module/Module.php:2109
900 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7937
 0.356 ms 1 /classes/Product.php:2902
966 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.356 ms 1 /classes/stock/StockAvailable.php:778
1112 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 14 AND `id_shop` = 1 LIMIT 1
 0.356 ms 1 /classes/module/Module.php:2109
376 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 131 AND `id_shop` = 1 LIMIT 1
 0.355 ms 1 /classes/module/Module.php:2109
734 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 15 AND `id_shop` = 1 LIMIT 1
 0.355 ms 1 /classes/module/Module.php:2109
757 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.355 ms 1 /classes/Smarty/SmartyCustom.php:216
856 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563418
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.355 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1027 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 404) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.355 ms 1 /classes/stock/StockAvailable.php:753
1032 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 404
 0.355 ms 1 /classes/Product.php:2902
93 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 285 AND id_shop=1 LIMIT 1
 0.354 ms 1 /classes/Product.php:6848
828 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6171
 0.354 ms 1 /classes/Product.php:2902
884 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.354 ms 1 /classes/stock/StockAvailable.php:806
409 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.354 ms 1 /classes/Product.php:5639
366 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "jmsajaxsearch" LIMIT 1
 0.353 ms 0 /classes/module/Module.php:2636
733 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customersignin" LIMIT 1
 0.353 ms 1 /classes/module/Module.php:2636
739 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
 0.353 ms 1 /classes/module/Module.php:2109
941 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5773 LIMIT 1
 0.353 ms 12 /modules/an_wishlist/classes/an_wish_products.php:124
990 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.353 ms 1 /classes/stock/StockAvailable.php:778
670 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6171
 0.353 ms 1 /classes/Product.php:2902
1044 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9194
 0.353 ms 1 /classes/Product.php:2902
1063 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.353 ms 1 /classes/stock/StockAvailable.php:753
57 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_reviews" LIMIT 1
 0.352 ms 0 /classes/module/Module.php:2636
192 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 294 AND id_shop=1 LIMIT 1
 0.352 ms 1 /classes/Product.php:6848
658 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7315 AND `id_group` = 1 LIMIT 1
 0.352 ms 0 /classes/GroupReduction.php:156
361 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.351 ms 0 /classes/module/Module.php:2109
369 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.351 ms 0 /classes/module/Module.php:2109
400 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 10992
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.351 ms 1 /classes/SpecificPrice.php:259
475 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.351 ms 1 /classes/Product.php:5639
706 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9194
 0.351 ms 1 /classes/Product.php:2902
215 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 296 AND `id_group` = 1 LIMIT 1
 0.351 ms 0 /classes/GroupReduction.php:156
403 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 10992 AND id_shop=1 LIMIT 1
 0.351 ms 1 /classes/Product.php:6848
676 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8861
 0.351 ms 1 /classes/Product.php:2902
678 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8277
 0.351 ms 1 /classes/Product.php:2902
1002 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.351 ms 1 /classes/stock/StockAvailable.php:778
499 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7937
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.350 ms 1 /classes/SpecificPrice.php:259
358 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labblocksearch" LIMIT 1
 0.350 ms 0 /classes/module/Module.php:2636
371 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.350 ms 0 /classes/module/Module.php:2109
652 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.350 ms 1 /classes/Product.php:5639
718 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.350 ms 1 /classes/module/Module.php:2636
797 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 9503 LIMIT 1
 0.350 ms 3 /modules/an_wishlist/classes/an_wish_products.php:124
1039 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.350 ms 1 /classes/stock/StockAvailable.php:753
281 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 302 AND `id_group` = 1 LIMIT 1
 0.349 ms 0 /classes/GroupReduction.php:156
1020 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4094
 0.349 ms 1 /classes/Product.php:2902
1073 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
 0.349 ms 1 /classes/Country.php:402
565 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5479
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.349 ms 1 /classes/SpecificPrice.php:259
812 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7732) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.348 ms 1 /classes/stock/StockAvailable.php:806
986 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5139
 0.348 ms 3 /classes/Product.php:3423
585 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.348 ms 1 /classes/Product.php:5639
674 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9135
 0.348 ms 1 /classes/Product.php:2902
1078 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572863))
 0.348 ms 1 /classes/Smarty/SmartyCustom.php:265
491 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8043 AND id_shop=1 LIMIT 1
 0.347 ms 1 /classes/Product.php:6848
609 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4094
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.347 ms 1 /classes/SpecificPrice.php:259
688 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6048
 0.347 ms 1 /classes/Product.php:2902
711 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_theme" LIMIT 1
 0.347 ms 1 /classes/module/Module.php:2636
872 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.347 ms 1 /classes/stock/StockAvailable.php:806
992 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.347 ms 1 /classes/stock/StockAvailable.php:806
416 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 9503) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.346 ms 1 /classes/stock/StockAvailable.php:453
458 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 9135 AND id_shop=1 LIMIT 1
 0.346 ms 1 /classes/Product.php:6848
68 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.346 ms 1 /classes/Product.php:5639
126 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 288 AND id_shop=1 LIMIT 1
 0.346 ms 1 /classes/Product.php:6848
349 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 25 AND `id_shop` = 1 LIMIT 1
 0.346 ms 1 /classes/module/Module.php:2109
353 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.346 ms 0 /classes/module/Module.php:2109
574 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.346 ms 1 /classes/Product.php:5639
579 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5143 AND id_shop=1 LIMIT 1
 0.346 ms 1 /classes/Product.php:6848
682 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7937
 0.346 ms 1 /classes/Product.php:2902
453 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.345 ms 1 /classes/Product.php:5639
570 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.345 ms 1 /classes/stock/StockAvailable.php:453
576 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5143
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.345 ms 1 /classes/SpecificPrice.php:259
659 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.345 ms 1 /classes/stock/StockAvailable.php:453
932 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.345 ms 1 /classes/stock/StockAvailable.php:806
1121 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 150 AND `id_shop` = 1 LIMIT 1
 0.345 ms 1 /classes/module/Module.php:2109
259 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 300 AND `id_group` = 1 LIMIT 1
 0.344 ms 0 /classes/GroupReduction.php:156
510 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7733
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.344 ms 1 /classes/SpecificPrice.php:259
598 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4673
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.344 ms 1 /classes/SpecificPrice.php:259
352 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "blocksearch_mod" LIMIT 1
 0.343 ms 0 /classes/module/Module.php:2636
908 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.343 ms 1 /classes/stock/StockAvailable.php:806
972 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5479
 0.343 ms 1 /classes/Product.php:2902
1105 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572863))
 0.343 ms 1 /classes/Smarty/SmartyCustom.php:265
602 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4673 AND `id_group` = 1 LIMIT 1
 0.343 ms 0 /classes/GroupReduction.php:156
105 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 286 AND `id_group` = 1 LIMIT 1
 0.342 ms 0 /classes/GroupReduction.php:156
666 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9503
 0.342 ms 1 /classes/Product.php:2902
672 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2972
 0.342 ms 1 /classes/Product.php:2902
859 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.342 ms 1 /classes/stock/StockAvailable.php:753
1040 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 9194) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.342 ms 1 /classes/stock/StockAvailable.php:806
690 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5773
 0.342 ms 1 /classes/Product.php:2902
716 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_simplefreeshippingline" LIMIT 1
 0.342 ms 1 /classes/module/Module.php:2636
1119 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 148 AND `id_shop` = 1 LIMIT 1
 0.342 ms 1 /classes/module/Module.php:2109
625 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 404 AND `id_group` = 1 LIMIT 1
 0.341 ms 0 /classes/GroupReduction.php:156
414 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 9503 AND id_shop=1 LIMIT 1
 0.341 ms 1 /classes/Product.php:6848
442 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.341 ms 1 /classes/Product.php:5639
702 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4094
 0.341 ms 1 /classes/Product.php:2902
351 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.340 ms 0 /classes/module/Module.php:2109
444 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 2972
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.340 ms 1 /classes/SpecificPrice.php:259
559 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.340 ms 1 /classes/stock/StockAvailable.php:453
710 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7315
 0.340 ms 1 /classes/Product.php:2902
735 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_wishlist" LIMIT 1
 0.340 ms 1 /classes/module/Module.php:2636
775 
SELECT SQL_NO_CACHE `iso_code`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
 0.340 ms 1 /classes/Country.php:275
226 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 297 AND `id_group` = 1 LIMIT 1
 0.339 ms 0 /classes/GroupReduction.php:156
357 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.339 ms 0 /classes/module/Module.php:2109
558 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5603 AND `id_group` = 1 LIMIT 1
 0.339 ms 0 /classes/GroupReduction.php:156
626 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 404) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.339 ms 1 /classes/stock/StockAvailable.php:453
521 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7361
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.339 ms 1 /classes/SpecificPrice.php:259
526 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.339 ms 1 /classes/stock/StockAvailable.php:453
612 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4094 AND id_shop=1 LIMIT 1
 0.338 ms 1 /classes/Product.php:6848
696 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5143
 0.338 ms 1 /classes/Product.php:2902
893 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7937 LIMIT 1
 0.338 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
624 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 404 AND id_shop=1 LIMIT 1
 0.338 ms 1 /classes/Product.php:6848
632 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 9194
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.338 ms 1 /classes/SpecificPrice.php:259
1004 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.338 ms 1 /classes/stock/StockAvailable.php:806
535 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6048 AND id_shop=1 LIMIT 1
 0.337 ms 1 /classes/Product.php:6848
568 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5479 AND id_shop=1 LIMIT 1
 0.337 ms 1 /classes/Product.php:6848
354 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tmsearch" LIMIT 1
 0.337 ms 0 /classes/module/Module.php:2636
543 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.337 ms 1 /classes/SpecificPrice.php:259
587 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5139
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.337 ms 1 /classes/SpecificPrice.php:259
726 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 125 AND `id_shop` = 1 LIMIT 1
 0.337 ms 1 /classes/module/Module.php:2109
847 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.337 ms 1 /classes/stock/StockAvailable.php:753
513 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7733 AND id_shop=1 LIMIT 1
 0.336 ms 1 /classes/Product.php:6848
1016 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.336 ms 1 /classes/stock/StockAvailable.php:806
303 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 304 AND `id_group` = 1 LIMIT 1
 0.336 ms 0 /classes/GroupReduction.php:156
431 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.336 ms 1 /classes/Product.php:5639
613 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4094 AND `id_group` = 1 LIMIT 1
 0.336 ms 0 /classes/GroupReduction.php:156
182 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 293 AND `id_group` = 1 LIMIT 1
 0.335 ms 0 /classes/GroupReduction.php:156
514 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7733 AND `id_group` = 1 LIMIT 1
 0.335 ms 0 /classes/GroupReduction.php:156
548 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.335 ms 1 /classes/stock/StockAvailable.php:453
657 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7315 AND id_shop=1 LIMIT 1
 0.335 ms 1 /classes/Product.php:6848
744 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572862))
 0.334 ms 1 /classes/Smarty/SmartyCustom.php:265
788 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 10992) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.334 ms 1 /classes/stock/StockAvailable.php:806
405 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 10992) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.333 ms 1 /classes/stock/StockAvailable.php:453
524 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7361 AND id_shop=1 LIMIT 1
 0.333 ms 1 /classes/Product.php:6848
546 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5773 AND id_shop=1 LIMIT 1
 0.333 ms 1 /classes/Product.php:6848
787 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 10992) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.333 ms 1 /classes/stock/StockAvailable.php:753
455 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 9135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.332 ms 1 /classes/SpecificPrice.php:259
919 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.332 ms 1 /classes/stock/StockAvailable.php:753
1052 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 9171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.332 ms 1 /classes/stock/StockAvailable.php:806
607 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.332 ms 1 /classes/Product.php:5639
895 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.332 ms 1 /classes/stock/StockAvailable.php:753
635 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 9194 AND id_shop=1 LIMIT 1
 0.331 ms 1 /classes/Product.php:6848
47 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
 0.331 ms 1 /classes/Country.php:402
477 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8277
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.331 ms 1 /classes/SpecificPrice.php:259
552 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.331 ms 1 /classes/Product.php:5639
620 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 6
AND `active` = 1 LIMIT 1
 0.331 ms 1 /classes/Manufacturer.php:316
647 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 9171 AND `id_group` = 1 LIMIT 1
 0.331 ms 0 /classes/GroupReduction.php:156
648 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 9171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.331 ms 1 /classes/stock/StockAvailable.php:453
1051 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9171) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.331 ms 1 /classes/stock/StockAvailable.php:753
356 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ttblocksearch" LIMIT 1
 0.330 ms 0 /classes/module/Module.php:2636
537 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:453
592 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:453
643 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 9171
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.330 ms 1 /classes/SpecificPrice.php:259
704 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 404
 0.330 ms 1 /classes/Product.php:2902
712 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 76 AND `id_shop` = 1 LIMIT 1
 0.330 ms 1 /classes/module/Module.php:2109
741 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
 0.330 ms 1 /classes/module/Module.php:2109
799 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9503) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:753
835 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:753
836 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 2972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:806
955 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.330 ms 1 /classes/stock/StockAvailable.php:753
459 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 9135 AND `id_group` = 1 LIMIT 1
 0.328 ms 0 /classes/GroupReduction.php:156
464 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.328 ms 1 /classes/Product.php:5639
469 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8861 AND id_shop=1 LIMIT 1
 0.328 ms 1 /classes/Product.php:6848
717 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 157 AND `id_shop` = 1 LIMIT 1
 0.328 ms 1 /classes/module/Module.php:2109
800 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 9503) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.328 ms 1 /classes/stock/StockAvailable.php:806
447 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 2972 AND id_shop=1 LIMIT 1
 0.328 ms 1 /classes/Product.php:6848
471 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.327 ms 1 /classes/stock/StockAvailable.php:453
525 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7361 AND `id_group` = 1 LIMIT 1
 0.327 ms 0 /classes/GroupReduction.php:156
480 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8277 AND id_shop=1 LIMIT 1
 0.327 ms 1 /classes/Product.php:6848
360 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labsearch" LIMIT 1
 0.326 ms 0 /classes/module/Module.php:2636
370 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tdsearchblock" LIMIT 1
 0.326 ms 0 /classes/module/Module.php:2636
427 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7732) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.326 ms 1 /classes/stock/StockAvailable.php:453
530 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.326 ms 1 /classes/Product.php:5639
1028 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 404) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.326 ms 1 /classes/stock/StockAvailable.php:806
470 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8861 AND `id_group` = 1 LIMIT 1
 0.325 ms 0 /classes/GroupReduction.php:156
668 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7732
 0.325 ms 1 /classes/Product.php:2902
160 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 291 AND `id_group` = 1 LIMIT 1
 0.324 ms 0 /classes/GroupReduction.php:156
740 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_logo" LIMIT 1
 0.324 ms 1 /classes/module/Module.php:2636
956 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.324 ms 1 /classes/stock/StockAvailable.php:806
684 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7733
 0.323 ms 1 /classes/Product.php:2902
698 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5139
 0.323 ms 1 /classes/Product.php:2902
723 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_client_service" LIMIT 1
 0.323 ms 1 /classes/module/Module.php:2636
466 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8861
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.322 ms 1 /classes/SpecificPrice.php:259
708 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9171
 0.322 ms 1 /classes/Product.php:2902
943 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.322 ms 1 /classes/stock/StockAvailable.php:753
365 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.322 ms 0 /classes/module/Module.php:2109
415 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 9503 AND `id_group` = 1 LIMIT 1
 0.322 ms 0 /classes/GroupReduction.php:156
515 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.322 ms 1 /classes/stock/StockAvailable.php:453
433 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6171
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.318 ms 1 /classes/SpecificPrice.php:259
714 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 117 LIMIT 1
 0.318 ms 1 /classes/Hook.php:244
601 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4673 AND id_shop=1 LIMIT 1
 0.317 ms 1 /classes/Product.php:6848
493 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.317 ms 1 /classes/stock/StockAvailable.php:453
621 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 404
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.316 ms 1 /classes/SpecificPrice.php:259
630 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.316 ms 1 /classes/Product.php:5639
692 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5603
 0.316 ms 1 /classes/Product.php:2902
654 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7315
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.316 ms 1 /classes/SpecificPrice.php:259
646 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 9171 AND id_shop=1 LIMIT 1
 0.315 ms 1 /classes/Product.php:6848
460 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.315 ms 1 /classes/stock/StockAvailable.php:453
618 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.315 ms 1 /classes/Product.php:5639
680 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8043
 0.315 ms 1 /classes/Product.php:2902
411 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 9503
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.314 ms 1 /classes/SpecificPrice.php:259
508 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.313 ms 1 /classes/Product.php:5639
636 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 9194 AND `id_group` = 1 LIMIT 1
 0.313 ms 0 /classes/GroupReduction.php:156
596 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.311 ms 1 /classes/Product.php:5639
590 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5139 AND id_shop=1 LIMIT 1
 0.310 ms 1 /classes/Product.php:6848
536 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6048 AND `id_group` = 1 LIMIT 1
 0.309 ms 0 /classes/GroupReduction.php:156
725 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "darkmode" LIMIT 1
 0.309 ms 1 /classes/module/Module.php:2636
404 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 10992 AND `id_group` = 1 LIMIT 1
 0.308 ms 0 /classes/GroupReduction.php:156
1116 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572863))
 0.307 ms 1 /classes/Smarty/SmartyCustom.php:265
557 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5603 AND id_shop=1 LIMIT 1
 0.307 ms 1 /classes/Product.php:6848
519 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.306 ms 1 /classes/Product.php:5639
426 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7732 AND `id_group` = 1 LIMIT 1
 0.305 ms 0 /classes/GroupReduction.php:156
436 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6171 AND id_shop=1 LIMIT 1
 0.305 ms 1 /classes/Product.php:6848
437 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6171 AND `id_group` = 1 LIMIT 1
 0.305 ms 0 /classes/GroupReduction.php:156
547 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5773 AND `id_group` = 1 LIMIT 1
 0.304 ms 0 /classes/GroupReduction.php:156
569 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5479 AND `id_group` = 1 LIMIT 1
 0.303 ms 0 /classes/GroupReduction.php:156
720 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.303 ms 1 /classes/module/Module.php:2636
503 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7937 AND `id_group` = 1 LIMIT 1
 0.302 ms 0 /classes/GroupReduction.php:156
721 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
 0.302 ms 1 /classes/module/Module.php:2109
719 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
 0.299 ms 1 /classes/module/Module.php:2109
715 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 48 LIMIT 1
 0.297 ms 1 /classes/Hook.php:244
724 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 147 AND `id_shop` = 1 LIMIT 1
 0.296 ms 1 /classes/module/Module.php:2109

Doubles

48 queries 
SELECT image_shop.`id_image`
                    FROM `mangayo_image` i
                     INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries 
SELECT name FROM mangayo_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries 
SELECT *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `mangayo_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
48 queries 
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `mangayo_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
48 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries 
                            SELECT `id_tax_rules_group`
                            FROM `mangayo_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries 
			SELECT `reduction`
			FROM `mangayo_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries 
SELECT SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `mangayo_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM mangayo_feature_product pf
                LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN mangayo_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
48 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `mangayo_image` i
             INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
48 queries 
SELECT `id_product_attribute`
            FROM `mangayo_product_attribute`
            WHERE `id_product` = XX
34 queries 
SELECT `id_module` FROM `mangayo_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
25 queries 
            SELECT `id_wishlist`
            FROM `mangayo_an_wishlist`
            WHERE `id_customer` = XX
            AND `is_guest` = XX
            AND `id_shop` = XX LIMIT XX
24 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `mangayo_product_attribute` pa
             INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
24 queries 
                SELECT `id_category` FROM `mangayo_category_product`
                WHERE `id_product` = XX
24 queries 
            SELECT COUNT(*)
            FROM `mangayo_an_wishlist_products`
            WHERE `id_product` = XX LIMIT XX
24 queries 
SELECT out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT location
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT product_attribute_shop.id_product_attribute
                FROM mangayo_product_attribute pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries 
SELECT ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
                    a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
                    IFNULL(stock.quantity, XX) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
                    product_attribute_shop.`default_on`, pa.`reference`, pa.`eanXX`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
                    product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
                    pal.`available_now`, pal.`available_later`
                FROM `mangayo_product_attribute` pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
                LEFT JOIN `mangayo_product_attribute_lang` pal
                    ON (
                        pa.`id_product_attribute` = pal.`id_product_attribute` AND
                        pal.`id_lang` = XX)
                LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
                LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
                LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
                 INNER JOIN mangayo_attribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX)
                WHERE pa.`id_product` = XX
                    AND al.`id_lang` = XX
                    AND agl.`id_lang` = XX
                GROUP BY id_attribute_group, id_product_attribute
                ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
22 queries 
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
14 queries 
SELECT *
            FROM `mangayo_andropdown` d
            LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
            WHERE d.`id_anmenu` = XX
            AND `id_lang` = XX
            AND `active` = XX
            GROUP BY d.`id_andropdown`
            ORDER BY d.`position` ASC
10 queries 
SELECT *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = XX
WHERE (a.`id_cms` = XX) LIMIT XX
10 queries 
SELECT *
							FROM `mangayo_cms_lang`
							WHERE `id_cms` = XX AND `id_shop` = XX
6 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"an_megamenu|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
4 queries 
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries 
SELECT *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
3 queries 
							SELECT `name`
							FROM `mangayo_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_linklist|displayFooter|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
3 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_customeraccountlinks|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
2 queries 
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `mangayo_module` m
                LEFT JOIN `mangayo_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries 
SELECT `id_lang` FROM `mangayo_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries 
SELECT XX FROM `mangayo_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries 
			SELECT `need_identification_number`
			FROM `mangayo_country`
			WHERE `id_country` = XX LIMIT XX
2 queries 
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
2 queries 
			SELECT cl.`link_rewrite`
			FROM `mangayo_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
2 queries 
				SELECT tr.*
				FROM `mangayo_tax_rule` tr
				JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
SELECT c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = XX) LIMIT XX
2 queries 
				SELECT `name`
				FROM `mangayo_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries 
SELECT `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=XX) AND (`active`= XX)
2 queries 
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
2 queries 
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="" AND compile_id="charme" LIMIT XX
2 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"","charme", FROM_UNIXTIME(XX))
2 queries 
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="an_megamenu|XX|XX|XX|XX" AND compile_id="charme" LIMIT XX
2 queries 
SELECT *
            FROM `mangayo_anmenu` m
            LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
            
            WHERE m.`id_shop` = XX
            AND `id_lang` = XX
            AND `active` = XX
            
            GROUP BY m.`id_anmenu`
            ORDER BY m.`position` ASC
2 queries 
SELECT m.*, ml.`description`, ml.`short_description`
            FROM `mangayo_manufacturer` m
             INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)
            LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)
            WHERE m.`id_manufacturer` IN (XX)
            AND m.`active` = XX
            GROUP BY m.`id_manufacturer`
            ORDER BY m.`name`
2 queries 
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) as quantity, pl.`description`,
            pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
            pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
            m.`name` AS manufacturer_name,
            DATEDIFF(
                product_shop.`date_add`,
                DATE_SUB(
                    NOW(),
                    INTERVAL XX DAY
                )
            ) > XX AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
 INNER JOIN mangayo_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = XX AND pl.id_shop = XX 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
 LEFT JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX AND image_shop.cover=XX)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = XX
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
 LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX AND product_attribute_shop.default_on = XX)
 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
WHERE (p.`id_product` IN (XX))
GROUP BY product_shop.id_product
2 queries 
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
2 queries 
SELECT *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = XX
WHERE (a.`id_link_block` = XX) LIMIT XX
2 queries 
SELECT *
							FROM `mangayo_link_block_lang`
							WHERE `id_link_block` = XX

Tables stress

158 product
157 product_shop
155 stock_available
129 product_attribute
123 product_attribute_shop
99 image_shop
98 image
97 cart_product
71 feature_product
62 category_lang
55 product_attribute_combination
53 product_lang
52 specific_price
52 feature_value_lang
51 image_lang
49 feature_lang
49 feature
49 feature_shop
48 specific_price_priority
48 product_group_reduction_cache
48 pack
48 attribute
48 attribute_lang
48 attribute_group
44 module
37 module_shop
35 category_product
25 an_wishlist
24 an_productextratabs_labels_relations
24 an_productextratabs_labels_lang
24 an_wishlist_products
24 product_attribute_lang
24 attribute_group_lang
24 attribute_shop
21 category
14 andropdown
14 andropdown_lang
11 category_group
10 hook
10 category_shop
10 cms
10 cms_shop
10 cms_lang
9 manufacturer
6 product_sale
6 smarty_lazy_cache
5 lang
5 country
5 currency
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 manufacturer_shop
4 manufacturer_lang
4 feature_value
4 layered_indexable_feature_value_lang_value
3 hook_alias
3 image_type
3 link_block
3 link_block_shop
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 cart_rule_lang
2 smarty_last_flush
2 tax_rule
2 tax_rules_group
2 social_login_position
2 anmenu
2 anmenu_lang
2 link_block_lang
2 date_range
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 group_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 orders
1 hicookietype
1 hicookietype_lang
1 hicookietype_shop
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 dark_mode
1 an_trust_badges_widgets
1 an_trust_badges_widgets_lang
1 an_trust_badges_icons
1 connections
1 page_type
1 page
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 145 /classes/Link.php:113 (__construct) [id: 284]
/classes/Link.php:113 (__construct) [id: 285]
/classes/Link.php:113 (__construct) [id: 286]
/classes/Link.php:113 (__construct) [id: 287]
/classes/Link.php:113 (__construct) [id: 288]
/classes/Link.php:113 (__construct) [id: 289]
/classes/Link.php:113 (__construct) [id: 290]
/classes/Link.php:113 (__construct) [id: 291]
/classes/Link.php:113 (__construct) [id: 292]
/classes/Link.php:113 (__construct) [id: 293]
/classes/Link.php:113 (__construct) [id: 294]
/classes/Link.php:113 (__construct) [id: 295]
/classes/Link.php:113 (__construct) [id: 296]
/classes/Link.php:113 (__construct) [id: 297]
/classes/Link.php:113 (__construct) [id: 298]
/classes/Link.php:113 (__construct) [id: 299]
/classes/Link.php:113 (__construct) [id: 300]
/classes/Link.php:113 (__construct) [id: 301]
/classes/Link.php:113 (__construct) [id: 302]
/classes/Link.php:113 (__construct) [id: 303]
/classes/Link.php:113 (__construct) [id: 304]
/classes/Link.php:113 (__construct) [id: 305]
/classes/Link.php:113 (__construct) [id: 306]
/classes/Link.php:113 (__construct) [id: 307]
/modules/codwfeeplus/codwfeeplus.php:410 (__construct) [id: 12211]
/classes/Link.php:113 (__construct) [id: 10992]
/classes/Link.php:113 (__construct) [id: 9503]
/classes/Link.php:113 (__construct) [id: 7732]
/classes/Link.php:113 (__construct) [id: 6171]
/classes/Link.php:113 (__construct) [id: 2972]
/classes/Link.php:113 (__construct) [id: 9135]
/classes/Link.php:113 (__construct) [id: 8861]
/classes/Link.php:113 (__construct) [id: 8277]
/classes/Link.php:113 (__construct) [id: 8043]
/classes/Link.php:113 (__construct) [id: 7937]
/classes/Link.php:113 (__construct) [id: 7733]
/classes/Link.php:113 (__construct) [id: 7361]
/classes/Link.php:113 (__construct) [id: 6048]
/classes/Link.php:113 (__construct) [id: 5773]
/classes/Link.php:113 (__construct) [id: 5603]
/classes/Link.php:113 (__construct) [id: 5479]
/classes/Link.php:113 (__construct) [id: 5143]
/classes/Link.php:113 (__construct) [id: 5139]
/classes/Link.php:113 (__construct) [id: 4673]
/classes/Link.php:113 (__construct) [id: 4094]
/classes/Link.php:113 (__construct) [id: 404]
/classes/Link.php:113 (__construct) [id: 9194]
/classes/Link.php:113 (__construct) [id: 9171]
/classes/Link.php:113 (__construct) [id: 7315]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10992]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9503]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7732]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6171]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2972]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8861]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8277]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7937]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7733]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7361]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5603]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5479]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5143]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5139]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4673]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4094]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 404]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9194]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9171]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7315]
/classes/Link.php:113 (__construct) [id: 10992]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 10992]
/classes/Link.php:113 (__construct) [id: 10992]
/classes/Link.php:113 (__construct) [id: 9503]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 9503]
/classes/Link.php:113 (__construct) [id: 9503]
/classes/Link.php:113 (__construct) [id: 7732]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7732]
/classes/Link.php:113 (__construct) [id: 7732]
/classes/Link.php:113 (__construct) [id: 6171]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6171]
/classes/Link.php:113 (__construct) [id: 6171]
/classes/Link.php:113 (__construct) [id: 2972]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 2972]
/classes/Link.php:113 (__construct) [id: 2972]
/classes/Link.php:113 (__construct) [id: 9135]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 9135]
/classes/Link.php:113 (__construct) [id: 9135]
/classes/Link.php:113 (__construct) [id: 8861]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8861]
/classes/Link.php:113 (__construct) [id: 8861]
/classes/Link.php:113 (__construct) [id: 8277]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8277]
/classes/Link.php:113 (__construct) [id: 8277]
/classes/Link.php:113 (__construct) [id: 8043]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8043]
/classes/Link.php:113 (__construct) [id: 8043]
/classes/Link.php:113 (__construct) [id: 7937]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7937]
/classes/Link.php:113 (__construct) [id: 7937]
/classes/Link.php:113 (__construct) [id: 7733]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7733]
/classes/Link.php:113 (__construct) [id: 7733]
/classes/Link.php:113 (__construct) [id: 7361]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7361]
/classes/Link.php:113 (__construct) [id: 7361]
/classes/Link.php:113 (__construct) [id: 6048]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6048]
/classes/Link.php:113 (__construct) [id: 6048]
/classes/Link.php:113 (__construct) [id: 5773]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5773]
/classes/Link.php:113 (__construct) [id: 5773]
/classes/Link.php:113 (__construct) [id: 5603]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5603]
/classes/Link.php:113 (__construct) [id: 5603]
/classes/Link.php:113 (__construct) [id: 5479]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5479]
/classes/Link.php:113 (__construct) [id: 5479]
/classes/Link.php:113 (__construct) [id: 5143]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5143]
/classes/Link.php:113 (__construct) [id: 5143]
/classes/Link.php:113 (__construct) [id: 5139]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5139]
/classes/Link.php:113 (__construct) [id: 5139]
/classes/Link.php:113 (__construct) [id: 4673]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4673]
/classes/Link.php:113 (__construct) [id: 4673]
/classes/Link.php:113 (__construct) [id: 4094]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4094]
/classes/Link.php:113 (__construct) [id: 4094]
/classes/Link.php:113 (__construct) [id: 404]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 404]
/classes/Link.php:113 (__construct) [id: 404]
/classes/Link.php:113 (__construct) [id: 9194]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 9194]
/classes/Link.php:113 (__construct) [id: 9194]
/classes/Link.php:113 (__construct) [id: 9171]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 9171]
/classes/Link.php:113 (__construct) [id: 9171]
/classes/Link.php:113 (__construct) [id: 7315]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7315]
/classes/Link.php:113 (__construct) [id: 7315]
CMS 11 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 0]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 16]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 3]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 1]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 19]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 8]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 9]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 10]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 11]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 15]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 23]
Category 11 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 88]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 90]
/classes/Meta.php:380 (__construct) [id: 11]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/facebookproductad/lib/pixel/pixelCategory.php:46 (__construct) [id: 11]
/modules/facebookproductad/lib/moduleTools.php:481 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 11]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 11]
Country 7 /config/config.inc.php:146 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1725 (__construct) [id: 10]
/modules/paypal/paypal.php:324 (__construct) [id: 10]
/modules/paypal/classes/AbstractMethodPaypal.php:90 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/modules/ps_contactinfo/ps_contactinfo.php:104 (__construct) [id: 10]
State 5 /classes/AddressFormat.php:404 (__construct) [id: 211]
/classes/controller/FrontController.php:1724 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:93 (__construct) [id: 211]
/classes/AddressFormat.php:404 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:103 (__construct) [id: 211]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3691 (initialize) [id: ]
/classes/Product.php:3801 (__construct) [id: ]
/classes/Product.php:5936 (__construct) [id: ]
Language 4 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:559 (__construct) [id: 1]
/modules/facebookproductad/lib/hook/hookDisplay.php:90 (__construct) [id: 1]
/modules/facebookproductad/lib/pixel/pixelCategory.php:39 (__construct) [id: 1]
Cart 4 /classes/controller/FrontController.php:429 (__construct) [id: ]
/classes/controller/FrontController.php:499 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
AddressFormat 2 /classes/controller/FrontController.php:1719 (generateAddress) [id: ]
/modules/ps_contactinfo/ps_contactinfo.php:98 (generateAddress) [id: ]
Carrier 2 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
PrestaShop\Module\LinkList\Model\LinkBlock 2 /modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 1]
/modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 6]
BoldizArt\DarkMode\Model\DarkModeOptionsModel 2 /modules/darkmode/darkmode.php:227 (__construct) [id: 1]
/modules/darkmode/darkmode.php:227 (__construct) [id: 1]
OrderState 2 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:684 (getCurrencyInstance) [id: 1]
Hook 2 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
Configuration 2 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
ImageType 1 /modules/an_brandslider/an_brandslider.php:440 (__construct) [id: 14]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Risk 1 /classes/controller/FrontController.php:1652 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1649 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/api-platform/core/src/deprecation.php
40 /vendor/api-platform/core/src/Api/FilterInterface.php
41 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
42 /vendor/api-platform/core/src/deprecated_interfaces.php
43 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
58 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
61 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
62 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
65 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
66 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
67 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
68 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
69 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
70 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
71 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
72 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
73 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
74 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
75 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
76 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
77 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
78 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
88 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
89 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
97 /vendor/psr/container/src/ContainerInterface.php
98 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
99 /vendor/ircmaxell/password-compat/lib/password.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /classes/Smarty/SmartyCustom.php
196 /vendor/smarty/smarty/libs/Smarty.class.php
197 /vendor/smarty/smarty/libs/functions.php
198 /vendor/smarty/smarty/libs/Autoloader.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
208 /config/smartyfront.config.inc.php
209 /classes/Smarty/SmartyResourceModule.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
212 /classes/Smarty/SmartyResourceParent.php
213 /classes/Smarty/SmartyLazyRegister.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
215 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
216 /classes/Customer.php
217 /classes/Group.php
218 /classes/Link.php
219 /classes/shop/ShopUrl.php
220 /classes/Dispatcher.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
228 /src/Adapter/SymfonyContainer.php
229 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
230 /config/db_slave_server.inc.php
231 /modules/anblog/anblog.php
232 /modules/anblog/loader.php
233 /modules/anblog/classes/config.php
234 /modules/anblog/config.php
235 /modules/anblog/libs/Helper.php
236 /modules/anblog/libs/AnblogImage.php
237 /modules/anblog/classes/anBlogLikes.php
238 /modules/anblog/classes/anblogcat.php
239 /modules/anblog/classes/blog.php
240 /modules/anblog/classes/link.php
241 /modules/anblog/classes/comment.php
242 /modules/anblog/classes/sitemap.php
243 /modules/anblog/classes/anBlogWidgets.php
244 /src/Core/Security/Hashing.php
245 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
246 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
247 /classes/Translate.php
248 /modules/anblog/translations/it.php
249 /src/PrestaShopBundle/Translation/TranslatorComponent.php
250 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
251 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
252 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
253 /vendor/symfony/contracts/Translation/TranslatorInterface.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
255 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
256 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
257 /src/PrestaShopBundle/Translation/TranslatorInterface.php
258 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
259 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
260 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
264 /vendor/symfony/contracts/Translation/TranslatorTrait.php
265 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
266 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
267 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
268 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
269 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
270 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
274 /override/controllers/front/listing/CategoryController.php
275 /controllers/front/listing/CategoryController.php
276 /classes/controller/ProductListingFrontController.php
277 /classes/controller/ProductPresentingFrontController.php
278 /classes/controller/FrontController.php
279 /src/Adapter/Presenter/Object/ObjectPresenter.php
280 /src/Adapter/Presenter/PresenterInterface.php
281 /src/Adapter/Presenter/Cart/CartPresenter.php
282 /src/Adapter/Product/PriceFormatter.php
283 /src/Adapter/Image/ImageRetriever.php
284 /classes/tax/TaxConfiguration.php
285 /classes/Smarty/TemplateFinder.php
286 /classes/assets/StylesheetManager.php
287 /classes/assets/AbstractAssetManager.php
288 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
289 /classes/assets/JavascriptManager.php
290 /classes/assets/CccReducer.php
291 /classes/Category.php
292 /classes/webservice/WebserviceRequest.php
293 /src/Adapter/ContainerBuilder.php
294 /src/Adapter/Environment.php
295 /src/Core/EnvironmentInterface.php
296 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
297 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
298 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
299 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
300 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
301 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
302 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
303 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
304 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
305 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
306 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
308 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
309 /vendor/symfony/contracts/Service/ResetInterface.php
310 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
311 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
312 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
313 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
314 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
315 /vendor/symfony/contracts/Cache/ItemInterface.php
316 /vendor/psr/cache/src/CacheItemInterface.php
317 /vendor/psr/cache/src/CacheItemPoolInterface.php
318 /vendor/symfony/contracts/Cache/CacheInterface.php
319 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
321 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
323 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
324 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
325 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
326 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
328 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
330 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
332 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
333 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
334 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
335 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
380 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
381 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
382 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
383 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
384 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
387 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
388 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
389 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
390 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
391 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
392 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
393 /var/cache/dev/FrontContainer.php
394 /src/Adapter/Container/LegacyContainer.php
395 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
396 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
397 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
399 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
400 /vendor/psr/container/src/ContainerExceptionInterface.php
401 /vendor/psr/container/src/NotFoundExceptionInterface.php
402 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
404 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
405 /src/Adapter/Container/LegacyContainerInterface.php
406 /modules/contactform/vendor/autoload.php
407 /modules/contactform/vendor/composer/autoload_real.php
408 /modules/contactform/vendor/composer/autoload_static.php
409 /modules/dashactivity/vendor/autoload.php
410 /modules/dashactivity/vendor/composer/autoload_real.php
411 /modules/dashactivity/vendor/composer/autoload_static.php
412 /modules/dashtrends/vendor/autoload.php
413 /modules/dashtrends/vendor/composer/autoload_real.php
414 /modules/dashtrends/vendor/composer/autoload_static.php
415 /modules/dashproducts/vendor/autoload.php
416 /modules/dashproducts/vendor/composer/autoload_real.php
417 /modules/dashproducts/vendor/composer/autoload_static.php
418 /modules/graphnvd3/vendor/autoload.php
419 /modules/graphnvd3/vendor/composer/autoload_real.php
420 /modules/graphnvd3/vendor/composer/autoload_static.php
421 /modules/gridhtml/vendor/autoload.php
422 /modules/gridhtml/vendor/composer/autoload_real.php
423 /modules/gridhtml/vendor/composer/autoload_static.php
424 /modules/ps_banner/vendor/autoload.php
425 /modules/ps_banner/vendor/composer/autoload_real.php
426 /modules/ps_banner/vendor/composer/platform_check.php
427 /modules/ps_banner/vendor/composer/autoload_static.php
428 /modules/ps_categorytree/vendor/autoload.php
429 /modules/ps_categorytree/vendor/composer/autoload_real.php
430 /modules/ps_categorytree/vendor/composer/platform_check.php
431 /modules/ps_categorytree/vendor/composer/autoload_static.php
432 /modules/ps_contactinfo/vendor/autoload.php
433 /modules/ps_contactinfo/vendor/composer/autoload_real.php
434 /modules/ps_contactinfo/vendor/composer/platform_check.php
435 /modules/ps_contactinfo/vendor/composer/autoload_static.php
436 /modules/ps_currencyselector/vendor/autoload.php
437 /modules/ps_currencyselector/vendor/composer/autoload_real.php
438 /modules/ps_currencyselector/vendor/composer/platform_check.php
439 /modules/ps_currencyselector/vendor/composer/autoload_static.php
440 /modules/ps_customeraccountlinks/vendor/autoload.php
441 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
442 /modules/ps_customeraccountlinks/vendor/composer/platform_check.php
443 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
444 /modules/ps_customersignin/vendor/autoload.php
445 /modules/ps_customersignin/vendor/composer/autoload_real.php
446 /modules/ps_customersignin/vendor/composer/platform_check.php
447 /modules/ps_customersignin/vendor/composer/autoload_static.php
448 /modules/ps_customtext/vendor/autoload.php
449 /modules/ps_customtext/vendor/composer/autoload_real.php
450 /modules/ps_customtext/vendor/composer/platform_check.php
451 /modules/ps_customtext/vendor/composer/autoload_static.php
452 /modules/ps_emailsubscription/vendor/autoload.php
453 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
454 /modules/ps_emailsubscription/vendor/composer/platform_check.php
455 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
456 /modules/ps_faviconnotificationbo/vendor/autoload.php
457 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
458 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
459 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
460 /modules/ps_featuredproducts/vendor/autoload.php
461 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
462 /modules/ps_featuredproducts/vendor/composer/platform_check.php
463 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
464 /modules/ps_languageselector/vendor/autoload.php
465 /modules/ps_languageselector/vendor/composer/autoload_real.php
466 /modules/ps_languageselector/vendor/composer/platform_check.php
467 /modules/ps_languageselector/vendor/composer/autoload_static.php
468 /modules/ps_linklist/vendor/autoload.php
469 /modules/ps_linklist/vendor/composer/autoload_real.php
470 /modules/ps_linklist/vendor/composer/platform_check.php
471 /modules/ps_linklist/vendor/composer/autoload_static.php
472 /modules/ps_mainmenu/vendor/autoload.php
473 /modules/ps_mainmenu/vendor/composer/autoload_real.php
474 /modules/ps_mainmenu/vendor/composer/platform_check.php
475 /modules/ps_mainmenu/vendor/composer/autoload_static.php
476 /modules/ps_searchbar/vendor/autoload.php
477 /modules/ps_searchbar/vendor/composer/autoload_real.php
478 /modules/ps_searchbar/vendor/composer/platform_check.php
479 /modules/ps_searchbar/vendor/composer/autoload_static.php
480 /modules/ps_sharebuttons/vendor/autoload.php
481 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
482 /modules/ps_sharebuttons/vendor/composer/platform_check.php
483 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
484 /modules/ps_shoppingcart/vendor/autoload.php
485 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
486 /modules/ps_shoppingcart/vendor/composer/platform_check.php
487 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
488 /modules/ps_socialfollow/vendor/autoload.php
489 /modules/ps_socialfollow/vendor/composer/autoload_real.php
490 /modules/ps_socialfollow/vendor/composer/platform_check.php
491 /modules/ps_socialfollow/vendor/composer/autoload_static.php
492 /modules/ps_themecusto/vendor/autoload.php
493 /modules/ps_themecusto/vendor/composer/autoload_real.php
494 /modules/ps_themecusto/vendor/composer/platform_check.php
495 /modules/ps_themecusto/vendor/composer/autoload_static.php
496 /modules/pagesnotfound/vendor/autoload.php
497 /modules/pagesnotfound/vendor/composer/autoload_real.php
498 /modules/pagesnotfound/vendor/composer/autoload_static.php
499 /modules/psgdpr/vendor/autoload.php
500 /modules/psgdpr/vendor/composer/autoload_real.php
501 /modules/psgdpr/vendor/composer/autoload_static.php
502 /modules/ps_facetedsearch/vendor/autoload.php
503 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
505 /modules/ps_categoryproducts/vendor/autoload.php
506 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
507 /modules/ps_categoryproducts/vendor/composer/platform_check.php
508 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
509 /modules/ps_viewedproduct/vendor/autoload.php
510 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
511 /modules/ps_viewedproduct/vendor/composer/platform_check.php
512 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
513 /modules/ps_crossselling/vendor/autoload.php
514 /modules/ps_crossselling/vendor/composer/autoload_real.php
515 /modules/ps_crossselling/vendor/composer/platform_check.php
516 /modules/ps_crossselling/vendor/composer/autoload_static.php
517 /modules/ps_bestsellers/vendor/autoload.php
518 /modules/ps_bestsellers/vendor/composer/autoload_real.php
519 /modules/ps_bestsellers/vendor/composer/platform_check.php
520 /modules/ps_bestsellers/vendor/composer/autoload_static.php
521 /modules/ps_dataprivacy/vendor/autoload.php
522 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
523 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
524 /modules/sociallogin/vendor/autoload.php
525 /modules/sociallogin/vendor/composer/autoload_real.php
526 /modules/sociallogin/vendor/composer/autoload_static.php
527 /modules/sociallogin/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
528 /modules/eicaptcha/vendor/autoload.php
529 /modules/eicaptcha/vendor/composer/autoload_real.php
530 /modules/eicaptcha/vendor/composer/platform_check.php
531 /modules/eicaptcha/vendor/composer/autoload_static.php
532 /modules/eicaptcha/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
533 /modules/eicaptcha/vendor/symfony/string/Resources/functions.php
534 /modules/paypal/vendor/autoload.php
535 /modules/paypal/vendor/composer/autoload_real.php
536 /modules/paypal/vendor/composer/autoload_static.php
537 /modules/paypal/vendor/paragonie/random_compat/lib/random.php
538 /modules/paypal/vendor/symfony/polyfill-php70/bootstrap.php
539 /modules/paypal/vendor/guzzlehttp/psr7/src/functions_include.php
540 /modules/paypal/vendor/guzzlehttp/psr7/src/functions.php
541 /modules/ps_emailalerts/vendor/autoload.php
542 /modules/ps_emailalerts/vendor/composer/autoload_real.php
543 /modules/ps_emailalerts/vendor/composer/platform_check.php
544 /modules/ps_emailalerts/vendor/composer/autoload_static.php
545 /modules/darkmode/vendor/autoload.php
546 /modules/darkmode/vendor/composer/autoload_real.php
547 /modules/darkmode/vendor/composer/platform_check.php
548 /modules/darkmode/vendor/composer/autoload_static.php
549 /modules/payplug/vendor/autoload.php
550 /modules/payplug/vendor/composer/autoload_real.php
551 /modules/payplug/vendor/composer/autoload_static.php
552 /modules/app_endpoint/vendor/autoload.php
553 /modules/app_endpoint/vendor/composer/autoload_real.php
554 /modules/app_endpoint/vendor/composer/platform_check.php
555 /modules/app_endpoint/vendor/composer/autoload_static.php
556 /modules/autoupgrade/vendor/autoload.php
557 /modules/autoupgrade/vendor/composer/autoload_real.php
558 /modules/autoupgrade/vendor/composer/autoload_static.php
559 /modules/ps_specials/vendor/autoload.php
560 /modules/ps_specials/vendor/composer/autoload_real.php
561 /modules/ps_specials/vendor/composer/autoload_static.php
562 /modules/mangayo_assistant/vendor/autoload.php
563 /modules/mangayo_assistant/vendor/composer/autoload_real.php
564 /modules/mangayo_assistant/vendor/composer/autoload_static.php
565 /src/Core/Localization/Locale/Repository.php
566 /src/Core/Localization/Locale/RepositoryInterface.php
567 /src/Core/Localization/CLDR/LocaleRepository.php
568 /src/Core/Localization/CLDR/LocaleDataSource.php
569 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
570 /src/Core/Data/Layer/AbstractDataLayer.php
571 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
572 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
573 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
574 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
575 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
576 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
577 /vendor/symfony/contracts/Cache/CacheTrait.php
578 /vendor/psr/cache/src/InvalidArgumentException.php
579 /vendor/psr/cache/src/CacheException.php
580 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
584 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
585 /src/Core/Localization/CLDR/Reader.php
586 /src/Core/Localization/CLDR/ReaderInterface.php
587 /src/Core/Localization/Currency/Repository.php
588 /src/Core/Localization/Currency/RepositoryInterface.php
589 /src/Core/Localization/Currency/CurrencyDataSource.php
590 /src/Core/Localization/Currency/DataSourceInterface.php
591 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
592 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
593 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
594 /src/Adapter/Currency/CurrencyDataProvider.php
595 /src/Core/Currency/CurrencyDataProviderInterface.php
596 /src/Adapter/LegacyContext.php
597 /src/Adapter/Tools.php
598 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
599 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
600 /vendor/prestashop/decimal/src/Operation/Rounding.php
601 /src/Core/Localization/Locale.php
602 /src/Core/Localization/LocaleInterface.php
603 /src/Core/Localization/Specification/Price.php
604 /src/Core/Localization/Specification/Number.php
605 /src/Core/Localization/Specification/NumberInterface.php
606 /src/Core/Localization/Specification/Factory.php
607 /src/Core/Localization/CLDR/LocaleData.php
608 /src/Core/Localization/CLDR/NumberSymbolsData.php
609 /src/Core/Localization/CLDR/CurrencyData.php
610 /src/Core/Localization/CLDR/Locale.php
611 /src/Core/Localization/CLDR/LocaleInterface.php
612 /src/Core/Localization/Specification/NumberSymbolList.php
613 /classes/Currency.php
614 /src/Core/Localization/Currency/LocalizedCurrencyId.php
615 /src/Core/Localization/Currency/CurrencyData.php
616 /src/Core/Localization/Currency/CurrencyCollection.php
617 /src/Core/Localization/Currency.php
618 /src/Core/Localization/CurrencyInterface.php
619 /src/Core/Localization/Specification/NumberCollection.php
620 /src/Core/Localization/Number/Formatter.php
621 /classes/Cart.php
622 /src/Adapter/AddressFactory.php
623 /classes/CartRule.php
624 /classes/Product.php
625 /src/Core/Domain/Product/ValueObject/RedirectType.php
626 /src/Core/Util/DateTime/DateTime.php
627 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
628 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
629 /src/Core/Domain/Product/ValueObject/ProductType.php
630 /src/Core/Domain/Product/ValueObject/Reference.php
631 /src/Core/Domain/Product/ValueObject/Ean13.php
632 /src/Core/Domain/Product/ValueObject/Isbn.php
633 /src/Core/Domain/Product/ValueObject/Upc.php
634 /src/Core/Domain/Product/ProductSettings.php
635 /src/Core/Domain/Shop/ValueObject/ShopId.php
636 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
637 /modules/ps_emailsubscription/ps_emailsubscription.php
638 /src/Core/Module/WidgetInterface.php
639 /src/PrestaShopBundle/Translation/DomainNormalizer.php
640 /classes/Media.php
641 /modules/ps_socialfollow/ps_socialfollow.php
642 /modules/ps_emailalerts/ps_emailalerts.php
643 /modules/ps_emailalerts/MailAlert.php
644 /classes/ProductDownload.php
645 /classes/tax/Tax.php
646 /src/Core/Localization/CLDR/ComputingPrecision.php
647 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
648 /src/Core/Cart/Calculator.php
649 /src/Core/Cart/CartRowCollection.php
650 /src/Core/Cart/Fees.php
651 /src/Core/Cart/AmountImmutable.php
652 /src/Core/Cart/CartRuleCollection.php
653 /src/Core/Cart/CartRuleCalculator.php
654 /src/Adapter/Product/PriceCalculator.php
655 /classes/order/Order.php
656 /src/Core/Cart/CartRow.php
657 /vendor/prestashop/decimal/src/DecimalNumber.php
658 /vendor/prestashop/decimal/src/Builder.php
659 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
660 /classes/Gender.php
661 /classes/Risk.php
662 /classes/Meta.php
663 /classes/Address.php
664 /classes/ImageType.php
665 /classes/State.php
666 /src/Core/Security/PasswordPolicyConfiguration.php
667 /src/Core/Configuration/DataConfigurationInterface.php
668 /src/Core/Filter/FrontEndObject/MainFilter.php
669 /src/Core/Filter/FilterInterface.php
670 /src/Core/Filter/FrontEndObject/CartFilter.php
671 /src/Core/Filter/HashMapWhitelistFilter.php
672 /src/Core/Filter/CollectionFilter.php
673 /src/Core/Filter/FrontEndObject/ProductFilter.php
674 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
675 /src/Core/Filter/FrontEndObject/CustomerFilter.php
676 /src/Core/Filter/FrontEndObject/ShopFilter.php
677 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
678 /modules/ps_shoppingcart/ps_shoppingcart.php
679 /modules/ets_crosssell/ets_crosssell.php
680 /modules/ets_crosssell/Ets_crosssell_db.php
681 /modules/ets_crosssell/translations/it.php
682 /classes/Manufacturer.php
683 /src/Core/Util/String/StringModifier.php
684 /src/Core/Util/String/StringModifierInterface.php
685 /modules/ps_searchbar/ps_searchbar.php
686 /modules/an_productextratabs/an_productextratabs.php
687 /modules/an_productextratabs/classes/anTabsCombinations.php
688 /modules/an_productextratabs/classes/anProductTabs.php
689 /modules/an_productextratabs/classes/anProductTabsTplContent.php
690 /modules/an_productextratabs/classes/anProductTabsLabels.php
691 /modules/an_productextratabs/translations/it.php
692 /modules/an_client_service/an_client_service.php
693 /modules/an_client_service/translations/it.php
694 /modules/an_trust_badges/an_trust_badges.php
695 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php
696 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php
697 /modules/an_trust_badges/translations/it.php
698 /modules/an_user_testimonials/an_user_testimonials.php
699 /modules/an_user_testimonials/classes/AnUserTestimonials.php
700 /modules/an_user_testimonials/translations/it.php
701 /modules/an_accordion/an_accordion.php
702 /modules/an_accordion/classes/AnAccordionBlock.php
703 /modules/an_accordion/translations/it.php
704 /modules/an_homeslider/an_homeslider.php
705 /modules/an_homeslider/classes/anHomeSliderFiles.php
706 /modules/an_homeslider/classes/anHomeSlides.php
707 /modules/an_homeslider/classes/anHomeSliders.php
708 /modules/an_homeslider/hooks_ignore.php
709 /modules/an_homeslider/translations/it.php
710 /modules/an_homeproducts/an_homeproducts.php
711 /modules/an_homeproducts/classes/anHomeProductsBlocks.php
712 /modules/an_homeproducts/classes/anHomeProductFiles.php
713 /modules/an_homeproducts/classes/anHomeProductsBanners.php
714 /modules/an_homeproducts/translations/it.php
715 /modules/an_banners/an_banners.php
716 /modules/an_banners/classes/anBanners.php
717 /modules/an_banners/hooks_ignore.php
718 /modules/an_banners/translations/it.php
719 /modules/an_simplefreeshippingline/an_simplefreeshippingline.php
720 /modules/an_simplefreeshippingline/translations/it.php
721 /modules/an_homecategories/an_homecategories.php
722 /modules/an_homecategories/classes/anHomecatFiles.php
723 /modules/an_homecategories/classes/AnHomecategories.php
724 /modules/an_homecategories/translations/it.php
725 /modules/paypal/paypal.php
726 /modules/paypal/config_prod.php
727 /classes/PaymentModule.php
728 /modules/paypal/classes/Shortcut/ShortcutConfiguration.php
729 /modules/paypal/smarty/plugins/modifier.paypalreplace.php
730 /modules/paypal/translations/it.php
731 /modules/paypal/classes/Constants/PaypalConfigurations.php
732 /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php
733 /modules/paypal/classes/Constants/WebHookConf.php
734 /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php
735 /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php
736 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php
737 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php
738 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php
739 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php
740 /modules/paypal/diagnostic.php
741 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php
742 /modules/paypal/classes/AbstractMethodPaypal.php
743 /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php
744 /modules/paypal/classes/MethodEC.php
745 /modules/paypal/classes/WhiteList/WhiteListService.php
746 /modules/paypal/classes/API/PaypalApiManager.php
747 /modules/paypal/classes/API/PaypalApiManagerInterface.php
748 /modules/paypal/classes/API/PaypalVaultApiManagerInterface.php
749 /modules/paypal/classes/API/PaypalClient.php
750 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalHttpClient.php
751 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/HttpClient.php
752 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/ProductionEnvironment.php
753 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalEnvironment.php
754 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Environment.php
755 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Encoder.php
756 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Json.php
757 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer.php
758 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Text.php
759 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Multipart.php
760 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Form.php
761 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/AuthorizationInjector.php
762 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Injector.php
763 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/GzipInjector.php
764 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/FPTIInstrumentationInjector.php
765 /classes/Smarty/SmartyCustomTemplate.php
766 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
767 /var/cache/dev/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php
768 /modules/anscrolltop/anscrolltop.php
769 /modules/anscrolltop/translations/it.php
770 /modules/darkmode/darkmode.php
771 /src/Adapter/Localization/LegacyTranslator.php
772 /modules/darkmode/translations/it.php
773 /modules/eicaptcha/eicaptcha.php
774 /modules/eicaptcha/translations/it.php
775 /modules/eicaptcha/src/Debugger.php
776 /modules/mangayo_assistant/mangayo_assistant.php
777 /modules/mangayo_assistant/translations/it.php
778 /modules/facebookproductad/facebookproductad.php
779 /modules/facebookproductad/vendor/autoload.php
780 /modules/facebookproductad/vendor/composer/autoload_real.php
781 /modules/facebookproductad/vendor/composer/platform_check.php
782 /modules/facebookproductad/vendor/composer/autoload_static.php
783 /modules/facebookproductad/translations/it.php
784 /modules/facebookproductad/lib/moduleTools.php
785 /modules/facebookproductad/conf/moduleConfiguration.php
786 /modules/facebookproductad/lib/hook/hookController.php
787 /modules/facebookproductad/lib/hook/hookDisplay.php
788 /modules/facebookproductad/lib/hook/hookBase.php
789 /modules/facebookproductad/lib/dao/moduleDao.php
790 /modules/facebookproductad/lib/pixel/basePixel.php
791 /modules/facebookproductad/lib/pixel/pixelCategory.php
792 /classes/Combination.php
793 /classes/stock/StockAvailable.php
794 /classes/SpecificPrice.php
795 /classes/tax/TaxManagerFactory.php
796 /classes/tax/TaxRulesTaxManager.php
797 /classes/tax/TaxManagerInterface.php
798 /classes/tax/TaxCalculator.php
799 /classes/GroupReduction.php
800 /classes/Pack.php
801 /classes/Feature.php
802 /var/cache/dev/smarty/compile/charme/b3/c8/1a/b3c81a5ca82982e30cc717b20aaf37611d4de76f_2.file.header.tpl.php
803 /modules/an_brandslider/an_brandslider.php
804 /modules/an_brandslider/translations/it.php
805 /modules/an_megamenu/an_megamenu.php
806 /modules/an_megamenu/classes/AnMenu.php
807 /modules/an_megamenu/classes/AnDropdown.php
808 /classes/controller/AdminController.php
809 /modules/an_megamenu/composite/AnMegaMenuConfigurator.php
810 /modules/an_megamenu/composite/AnMegaMenuMenuConfigurator.php
811 /modules/an_megamenu/composite/AnMegaMenuHooks.php
812 /modules/an_megamenu/composite/AnMegaMenuAjaxHandler.php
813 /modules/an_megamenu/composite/AnMegaMenuDropDownConfigurator.php
814 /modules/an_productattributes/an_productattributes.php
815 /modules/an_productattributes/classes/anProductAttr.php
816 /modules/an_productattributes/translations/it.php
817 /var/cache/dev/smarty/compile/charme/ed/2e/b6/ed2eb6a7d481b95124e291b11541581f4431489e_2.file.js_header.tpl.php
818 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
819 /modules/an_wishlist/an_wishlist.php
820 /modules/an_wishlist/classes/an_wish.php
821 /modules/an_wishlist/classes/an_wish_products.php
822 /modules/an_wishlist/classes/an_wishListing.php
823 /modules/an_wishlist/translations/it.php
824 /modules/an_stickyaddtocart/an_stickyaddtocart.php
825 /modules/an_stickyaddtocart/translations/it.php
826 /modules/an_theme/an_theme.php
827 /modules/an_theme/classes/InputFactory.php
828 /modules/an_theme/classes/Input.php
829 /modules/an_theme/classes/Validation.php
830 /modules/an_theme/classes/antheme.php
831 /modules/an_theme/classes/anThemeFiles.php
832 /modules/an_theme/translations/it.php
833 /themes/charme/assets/antheme/config/theme_fonts.php
834 /themes/charme/assets/antheme/config/theme_js.php
835 /themes/charme/assets/antheme/config/theme_css.php
836 /themes/charme/assets/antheme/config/vars.php
837 /themes/charme/assets/antheme/config/fields.php
838 /modules/sociallogin/sociallogin.php
839 /modules/sociallogin/translations/it.php
840 /modules/ps_googleanalytics/ps_googleanalytics.php
841 /modules/ps_googleanalytics/vendor/autoload.php
842 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
843 /modules/ps_googleanalytics/vendor/composer/platform_check.php
844 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
845 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
846 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
847 /var/cache/dev/smarty/compile/charme/d2/a4/03/d2a40332993e3600f818db0d45a227f1af331e1a_2.file.ps_googleanalytics.tpl.php
848 /modules/luminage_mail/luminage_mail.php
849 /modules/luminage_mail/translations/it.php
850 /modules/hioutofstocknotification/hioutofstocknotification.php
851 /modules/hioutofstocknotification/classes/HiPrestaModule.php
852 /modules/hioutofstocknotification/classes/outofstock.php
853 /modules/hioutofstocknotification/classes/sentemail.php
854 /modules/hioutofstocknotification/classes/statistic.php
855 /modules/hioutofstocknotification/classes/oosnpdf.php
856 /classes/pdf/HTMLTemplate.php
857 /modules/hioutofstocknotification/classes/adminForms.php
858 /modules/hioutofstocknotification/translations/it.php
859 /var/cache/dev/smarty/compile/charme/b2/c3/47/b2c3472b487ed27b1e317c435a1d8b7f737453cb_2.file.header.tpl.php
860 /modules/ambjolisearch/ambjolisearch.php
861 /modules/ambjolisearch/classes/AmbJolisearchModule.php
862 /modules/ambjolisearch/classes/AmbIndexation.php
863 /modules/ambjolisearch/classes/AmbSearch.php
864 /modules/ambjolisearch/classes/definitions.php
865 /modules/ambjolisearch/classes/JoliLink.php
866 /modules/ambjolisearch/classes/JoliLink-1.7.php
867 /modules/ambjolisearch/classes/AmbJolisearchModuleProxy.php
868 /modules/ambjolisearch/translations/it.php
869 /modules/hicookielaw/hicookielaw.php
870 /modules/hicookielaw/classes/HiPrestaModule.php
871 /modules/hicookielaw/classes/adminForms.php
872 /modules/hicookielaw/classes/consent.php
873 /modules/hicookielaw/classes/type.php
874 /modules/hicookielaw/translations/it.php
875 /var/cache/dev/smarty/compile/charme/0c/8b/7b/0c8b7bc449184adb2e93a99131724c331ff4e737_2.file.header.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
877 /modules/payplug/payplug.php
878 /modules/payplug/translations/it.php
879 /modules/payplug/classes/PayPlugDependencies.php
880 /modules/payplug/classes/DependenciesClass.php
881 /modules/payplug/src/utilities/validators/accountValidator.php
882 /modules/payplug/src/utilities/validators/browserValidator.php
883 /modules/payplug/src/utilities/validators/cardValidator.php
884 /modules/payplug/src/utilities/validators/lockValidator.php
885 /modules/payplug/src/utilities/validators/loggerValidator.php
886 /modules/payplug/src/utilities/validators/moduleValidator.php
887 /modules/payplug/src/utilities/validators/orderValidator.php
888 /modules/payplug/src/utilities/validators/paymentValidator.php
889 /modules/payplug/src/utilities/helpers/AmountHelper.php
890 /modules/payplug/src/utilities/helpers/CookiesHelper.php
891 /modules/payplug/src/utilities/helpers/FilesHelper.php
892 /modules/payplug/src/utilities/helpers/PhoneHelper.php
893 /modules/payplug/src/utilities/helpers/UserHelper.php
894 /modules/payplug/src/application/dependencies/PluginInit.php
895 /modules/payplug/src/application/dependencies/BaseClass.php
896 /modules/payplug/src/actions/CardAction.php
897 /modules/payplug/src/actions/ConfigurationAction.php
898 /modules/payplug/src/actions/MerchantTelemetryAction.php
899 /modules/payplug/src/actions/OnboardingAction.php
900 /modules/payplug/src/actions/OrderStateAction.php
901 /modules/payplug/src/actions/PaymentAction.php
902 /modules/payplug/src/models/entities/CacheEntity.php
903 /modules/payplug/src/models/entities/OneyEntity.php
904 /modules/payplug/src/models/entities/PluginEntity.php
905 /modules/payplug/src/models/entities/OrderStateEntity.php
906 /modules/payplug/src/application/adapter/AddressAdapter.php
907 /modules/payplug/src/interfaces/AddressInterface.php
908 /modules/payplug/src/application/adapter/AssignAdapter.php
909 /modules/payplug/src/interfaces/AssignInterface.php
910 /modules/payplug/src/application/adapter/CarrierAdapter.php
911 /modules/payplug/src/interfaces/CarrierInterface.php
912 /classes/Carrier.php
913 /modules/payplug/src/application/adapter/CartAdapter.php
914 /modules/payplug/src/interfaces/CartInterface.php
915 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
916 /modules/payplug/src/interfaces/ConfigurationInterface.php
917 /modules/payplug/src/application/adapter/ConstantAdapter.php
918 /modules/payplug/src/interfaces/ConstantInterface.php
919 /modules/payplug/src/application/adapter/ContextAdapter.php
920 /modules/payplug/src/interfaces/ContextInterface.php
921 /modules/payplug/src/application/adapter/CountryAdapter.php
922 /modules/payplug/src/interfaces/CountryInterface.php
923 /modules/payplug/src/application/adapter/CurrencyAdapter.php
924 /modules/payplug/src/interfaces/CurrencyInterface.php
925 /modules/payplug/src/application/adapter/CustomerAdapter.php
926 /modules/payplug/src/interfaces/CustomerInterface.php
927 /modules/payplug/src/application/adapter/DispatcherAdapter.php
928 /modules/payplug/src/interfaces/DispatcherInterface.php
929 /modules/payplug/src/application/adapter/LanguageAdapter.php
930 /modules/payplug/src/interfaces/LanguageInterface.php
931 /modules/payplug/src/application/adapter/MediaAdapter.php
932 /modules/payplug/src/interfaces/MediaInterface.php
933 /modules/payplug/src/application/adapter/MessageAdapter.php
934 /modules/payplug/src/interfaces/MessageInterface.php
935 /modules/payplug/src/application/adapter/ModuleAdapter.php
936 /modules/payplug/src/interfaces/ModuleInterface.php
937 /modules/payplug/src/application/adapter/OrderAdapter.php
938 /modules/payplug/src/interfaces/OrderInterface.php
939 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
940 /modules/payplug/src/interfaces/OrderHistoryInterface.php
941 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
942 /modules/payplug/src/interfaces/OrderSlipInterface.php
943 /modules/payplug/src/application/adapter/OrderStateAdapter.php
944 /modules/payplug/src/interfaces/OrderStateInterface.php
945 /classes/order/OrderState.php
946 /modules/payplug/src/application/adapter/ProductAdapter.php
947 /modules/payplug/src/interfaces/ProductInterface.php
948 /modules/payplug/src/application/adapter/QueryAdapter.php
949 /modules/payplug/src/interfaces/QueryInterface.php
950 /modules/payplug/src/application/adapter/ShopAdapter.php
951 /modules/payplug/src/interfaces/ShopInterface.php
952 /modules/payplug/src/application/adapter/ToolsAdapter.php
953 /modules/payplug/src/interfaces/ToolsInterface.php
954 /modules/payplug/src/application/adapter/TranslationAdapter.php
955 /modules/payplug/src/interfaces/TranslationInterface.php
956 /modules/payplug/src/application/adapter/ValidateAdapter.php
957 /modules/payplug/src/interfaces/ValidateInterface.php
958 /modules/payplug/src/models/classes/ApiRest.php
959 /modules/payplug/src/models/classes/Configuration.php
960 /modules/payplug/src/models/classes/Country.php
961 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
962 /modules/payplug/src/models/classes/Translation.php
963 /modules/payplug/translations/en.php
964 /modules/payplug/src/models/repositories/CardRepository.php
965 /modules/payplug/src/models/repositories/QueryRepository.php
966 /modules/payplug/src/models/repositories/CacheRepository.php
967 /modules/payplug/src/models/repositories/CountryRepository.php
968 /modules/payplug/src/models/repositories/LockRepository.php
969 /modules/payplug/src/models/repositories/LoggerRepository.php
970 /modules/payplug/src/models/repositories/ModuleRepository.php
971 /modules/payplug/src/models/repositories/OrderRepository.php
972 /modules/payplug/src/models/repositories/OrderStateRepository.php
973 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
974 /modules/payplug/src/models/repositories/PaymentRepository.php
975 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
976 /modules/payplug/src/models/repositories/ShopRepository.php
977 /modules/payplug/classes/MyLogPHP.php
978 /modules/payplug/src/repositories/LoggerRepository.php
979 /modules/payplug/src/models/entities/LoggerEntity.php
980 /modules/payplug/src/repositories/TranslationsRepository.php
981 /modules/payplug/src/repositories/SQLtableRepository.php
982 /modules/payplug/src/repositories/CacheRepository.php
983 /modules/payplug/src/repositories/OneyRepository.php
984 /modules/payplug/src/repositories/OrderStateRepository.php
985 /modules/payplug/src/repositories/InstallRepository.php
986 /modules/payplug/src/utilities/services/Browser.php
987 /modules/payplug/src/utilities/services/Routes.php
988 /modules/payplug/src/utilities/services/MerchantTelemetry.php
989 /modules/payplug/classes/ApiClass.php
990 /modules/payplug/classes/ApplePayClass.php
991 /modules/payplug/classes/AmountCurrencyClass.php
992 /modules/payplug/classes/AdminClass.php
993 /modules/payplug/classes/PayplugLock.php
994 /modules/payplug/classes/CartClass.php
995 /modules/payplug/classes/ConfigClass.php
996 /modules/payplug/classes/InstallmentClass.php
997 /modules/payplug/classes/HookClass.php
998 /modules/payplug/classes/MediaClass.php
999 /modules/payplug/classes/OrderClass.php
1000 /modules/payplug/classes/PaymentClass.php
1001 /modules/payplug/classes/RefundClass.php
1002 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1003 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1004 /var/cache/dev/smarty/compile/charme/6a/fd/5e/6afd5effcf983f0813cac21afbfc06523d64a8ee_2.file.messages.tpl.php
1005 /modules/app_endpoint/app_endpoint.php
1006 /modules/app_endpoint/translations/it.php
1007 /modules/codwfeeplus/codwfeeplus.php
1008 /modules/codwfeeplus/CODwFP.php
1009 /modules/codwfeeplus/translations/it.php
1010 /src/Core/Product/Search/ProductSearchContext.php
1011 /src/Core/Product/Search/ProductSearchQuery.php
1012 /src/Core/Product/Search/SortOrder.php
1013 /modules/ps_facetedsearch/ps_facetedsearch.php
1014 /modules/ps_facetedsearch/src/HookDispatcher.php
1015 /modules/ps_facetedsearch/src/Hook/Attribute.php
1016 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1017 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1018 /modules/ps_facetedsearch/src/Hook/Category.php
1019 /modules/ps_facetedsearch/src/Hook/Configuration.php
1020 /modules/ps_facetedsearch/src/Hook/Design.php
1021 /modules/ps_facetedsearch/src/Hook/Feature.php
1022 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1023 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1024 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1025 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1026 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1027 /modules/ps_facetedsearch/src/Hook/Product.php
1028 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1029 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1030 /modules/ps_facetedsearch/src/Filters/Provider.php
1031 /modules/ps_facetedsearch/src/URLSerializer.php
1032 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1033 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1034 /src/Core/Product/Search/FacetsRendererInterface.php
1035 /src/Core/Product/Search/ProductSearchProviderInterface.php
1036 /modules/ps_facetedsearch/src/Filters/Converter.php
1037 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1038 /modules/ambjolisearch/src/Amb_ProductSearchProvider.php
1039 /src/Core/Product/Search/ProductSearchResult.php
1040 /modules/ps_facetedsearch/src/Product/Search.php
1041 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1042 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1043 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1044 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1045 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1046 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1047 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1048 /modules/ps_facetedsearch/src/Filters/Products.php
1049 /modules/ps_facetedsearch/src/Filters/Block.php
1050 /src/Core/Product/Search/Facet.php
1051 /src/Core/Product/Search/Filter.php
1052 /src/Core/Product/Search/FacetCollection.php
1053 /classes/ProductAssembler.php
1054 /classes/ProductPresenterFactory.php
1055 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1056 /src/Adapter/Presenter/Product/ProductPresenter.php
1057 /src/Adapter/Product/ProductColorsRetriever.php
1058 /src/Adapter/HookManager.php
1059 /src/Core/Product/ProductPresentationSettings.php
1060 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1061 /src/Adapter/Presenter/Product/ProductLazyArray.php
1062 /src/Adapter/Presenter/AbstractLazyArray.php
1063 /classes/Image.php
1064 /src/Core/Image/ImageFormatConfiguration.php
1065 /src/Core/Image/ImageFormatConfigurationInterface.php
1066 /classes/FeatureFlag.php
1067 /src/Core/FeatureFlag/FeatureFlagSettings.php
1068 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1069 /vendor/prestashop/decimal/src/Operation/Addition.php
1070 /src/Core/Util/Inflector.php
1071 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1072 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1073 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1074 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1075 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1076 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1077 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1078 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1079 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1080 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1081 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1082 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1083 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1084 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1085 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1086 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1087 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1088 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1089 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1090 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1091 /var/cache/dev/smarty/compile/charme/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1093 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1094 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1095 /var/cache/dev/smarty/compile/charme/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1096 /src/Core/Product/Search/Pagination.php
1097 /modules/sociallogin/models/SocialLoginPosition.php
1098 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/66/81/f1/6681f1287ad4751f4330999bf7e5047ef3e52cec_2.file.category.tpl.php
1099 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ee/8c/21/ee8c21f25c301be5b9dae26ba3672f4427c6aeb2_2.file.product-list.tpl.php
1100 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/c1/e5/02/c1e502525a49748091427e0df780f90846bd9d90_2.file.layout-left-column.tpl.php
1101 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a2/43/0d/a2430dfc6da9bb5b779a9919d46af9cb98017def_2.file.layout-both-columns.tpl.php
1102 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a0/b9/f1/a0b9f11bc34eb90e03108a3780da705e4c424c76_2.file.head.tpl.php
1103 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5c/99/24/5c9924d502b61764c40eeba7cd7dda269692307d_2.file.stylesheets.tpl.php
1104 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/3b/3c/ff/3b3cff40db7c22a4ee30c69b5f51819b85be6d9c_2.file.preload.tpl.php
1105 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ad/54/e6/ad54e66984a22371c20ef3cde2b3e98bd215d8e8_2.file.javascript.tpl.php
1106 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/fd/59/0a/fd590a6b567acb629cd24ef142a6acc3994b20dd_2.file.product-activation.tpl.php
1107 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/6b/40/6a/6b406af67655c04b1b8bc34738282cebbf0034fb_2.file.header.tpl.php
1108 /var/cache/dev/smarty/compile/charme/ba/f0/71/baf0714d120e11446c0237301b6cccbc40531653_2.module.an_simplefreeshippinglineviewstemplatesfrontwidget.tpl.php
1109 /modules/ps_languageselector/ps_languageselector.php
1110 /modules/ps_currencyselector/ps_currencyselector.php
1111 /var/cache/dev/smarty/compile/charme/49/36/e5/4936e564782a528c3079f559922e796453f1af1a_2.module.an_client_serviceviewstemplatesfrontwidget.tpl.php
1112 /modules/darkmode/src/Model/DarkModeOptionsModel.php
1113 /modules/darkmode/src/Db/QueryBuilder.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_clearcache.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1116 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1117 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_cacheresourcefile.php
1118 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1120 /var/cache/dev/smarty/compile/charme/a3/cf/9f/a3cf9f8dbcef1e72a52283b913857be8db6a8b80_2.module.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.cache.php
1121 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1122 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1123 /var/cache/dev/smarty/cache/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php
1124 /modules/ps_customersignin/ps_customersignin.php
1125 /var/cache/dev/smarty/compile/charme/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1126 /var/cache/dev/smarty/compile/charme/62/b3/ea/62b3ea25f9be6f347bb81fe6309b35116e17553f_2.module.an_wishlistviewstemplatesfrontnav.tpl.php
1127 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1128 /var/cache/dev/smarty/compile/charme/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1129 /modules/an_logo/an_logo.php
1130 /modules/an_logo/translations/it.php
1131 /var/cache/dev/smarty/compile/charme/74/96/d2/7496d2b81ba6ced33a36c630e03cb86d3b647a4b_2.module.an_logoviewstemplatesfrontlogo.tpl.php
1132 /var/cache/dev/smarty/compile/charme/bd/eb/23/bdeb239cddb118da7e29251e756fe96cb3dbe26b_2.file.an_megamenu.tpl.cache.php
1133 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php
1134 /var/cache/dev/smarty/compile/charme/11/0e/c7/110ec72aa9921d2c382ad628bdb2f0bc5105a617_2.module.ps_searchbarps_searchbar.tpl.php
1135 /var/cache/dev/smarty/compile/charme/6a/4b/17/6a4b178cc6ac5016a51cc4db2dda74b30a8cd612_2.file.an_megamenu_mobile.tpl.cache.php
1136 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php
1137 /modules/paypal/classes/InstallmentBanner/BannerManager.php
1138 /modules/paypal/classes/InstallmentBanner/Banner.php
1139 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/b6/b4/37/b6b437561c01fc88997451a413028764044621b6_2.file.notifications.tpl.php
1140 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5b/7f/12/5b7f12aebdf137ed79e78dddcd112712d43e20b5_2.file.breadcrumb.tpl.php
1141 /modules/ps_categorytree/ps_categorytree.php
1142 /var/cache/dev/smarty/compile/charme/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1143 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1144 /var/cache/dev/smarty/compile/charme/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1145 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/22/46/68/2246682b55d5939ba2438c9cba4d4cef07b7d99c_2.file.products-top.tpl.php
1146 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/e7/d5/5d/e7d55de2607b7a3747d835209dfa0bf329274823_2.file.sort-orders.tpl.php
1147 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/cc/2a/92/cc2a920e103307f38418741dbd6eeb78d4f4244b_2.file.products.tpl.php
1148 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/64/de/36/64de36afa8ae49504410858f9ee0be9233599a2b_2.file.product.tpl.php
1149 /var/cache/dev/smarty/compile/charme/62/77/7b/62777bbf995f423da45bdc9d94b3b2255e0685b7_2.module.an_wishlistviewstemplatesfrontproductminiature.tpl.php
1150 /var/cache/dev/smarty/compile/charme/b8/c2/d3/b8c2d37a7784d2c0bb28c4512a21f9b34473d1ad_2.file.productattributes.tpl.php
1151 /var/cache/dev/smarty/compile/charme/c2/f6/38/c2f6388ad4d70d04993a1b28e28ed73fbe5270a8_2.module.an_productattributesviewstemplatesfrontproductattributeswrapper.tpl.php
1152 /var/cache/dev/smarty/compile/charme/50/e3/6e/50e36e4f3c2a4795be15b313ca9e72dc460a5959_2.file.product-variants.tpl.php
1153 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a9/33/f4/a933f46e6d0f30297d17cc3e63762fa9de0d686c_2.file.pagination.tpl.php
1154 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/03/b6/70/03b67016d311f010e0c867f508f78946bb5f1315_2.file.products-bottom.tpl.php
1155 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/38/2a/57/382a577075ddb0537c28ca99407fca0d658514ed_2.file.footer.tpl.php
1156 /modules/ps_contactinfo/ps_contactinfo.php
1157 /var/cache/dev/smarty/compile/charme/99/92/f3/9992f3fe04dd41bcec1a2029cf07bead637caf4d_2.module.ps_contactinfops_contactinfo.tpl.php
1158 /modules/ps_linklist/ps_linklist.php
1159 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php
1160 /modules/ps_linklist/src/Filter/LinkFilter.php
1161 /modules/ps_linklist/src/Filter/BestSalesRouteFilter.php
1162 /modules/ps_linklist/src/Filter/RouteFilterInterface.php
1163 /modules/ps_linklist/src/LegacyLinkBlockRepository.php
1164 /modules/ps_linklist/src/Model/LinkBlock.php
1165 /classes/CMS.php
1166 /var/cache/dev/smarty/compile/charme/90/65/48/906548e89c8c6025457ddaeffb1980a0c743b872_2.module.ps_linklistviewstemplateshooklinkblock.tpl.cache.php
1167 /var/cache/dev/smarty/cache/ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php
1168 /var/cache/dev/smarty/compile/charme/94/04/dd/9404dddf9d62e01629bc90a9cb65c9dd834a2134_2.module.darkmodeviewstemplatesfrontdarkmode_functions.tpl.cache.php
1169 /var/cache/dev/smarty/cache/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php
1170 /modules/ps_customeraccountlinks/ps_customeraccountlinks.php
1171 /var/cache/dev/smarty/compile/charme/42/f9/46/42f9461127ce7396a601c2484841253ea5ba658f_2.module.ps_customeraccountlinksps_customeraccountlinks.tpl.cache.php
1172 /var/cache/dev/smarty/cache/ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php
1173 /var/cache/dev/smarty/compile/charme/b7/0c/56/b70c564919bbf154e7811f43c0a130bb3dc49f9f_2.file.display_footer.tpl.php
1174 /modules/an_copyright/an_copyright.php
1175 /modules/an_copyright/translations/it.php
1176 /var/cache/dev/smarty/compile/charme/56/a5/c8/56a5c82cce1796d8dbfa7b0b327052e3fece4682_2.module.an_copyrightviewstemplatesfrontwidget.tpl.php
1177 /var/cache/dev/smarty/compile/charme/31/32/2b/31322b94623342814b8c7d4182cfda837762840e_2.module.an_trust_badgesviewstemplatesfrontwidget.tpl.php
1178 /modules/statsdata/statsdata.php
1179 /classes/Connection.php
1180 /classes/Page.php
1181 /classes/ConnectionsSource.php
1182 /classes/DateRange.php
1183 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1184 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1185 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1186 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1187 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1188 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1189 /var/cache/dev/smarty/compile/charme/9b/b4/49/9bb449ecf8392afc0ebd444efd0e58f7f03bd397_2.file.ga_tag.tpl.php