Manga

Manga

Tutti i manga sono protetti in una perfetta bustina protettiva su misura.

Filtri attivi

  • Categoria : Art Book
  • Categoria : Boys love
  • Categoria : Character Book
  • Categoria : Hentai
  • Categoria : Josei
  • Categoria : Manhua
  • Categoria : Manhwa
  • Categoria : Novel
  • Categoria : Shoujo
  • Categoria : Shoujo-Ai
  • Categoria : Shounen
  • Genere: Ecchi
  • Genere: Scolastico
Tokyo Revengers 31
  • -20%
  • -20%

Tokyo Revengers 31

5,20 € 6,50 €

Tokyo Revengers Volume: 31 Storia: Ken Wakui Disegni: Ken Wakui Formato: 12.5x18 Editore: JPOP Lingua: Italiano

The Quintessential Quintuplets 1
  • -20%
  • -20%

The Quintessential...

4,72 € 5,90 €

Quintessential Quintuplets  Volume: 1 Storia: Negi Haruba Disegni: Negi Haruba Formato: 12x16.9 Editore: J-POP Lingua: Italiano

Amanchu! 17
  • -20%
  • -20%

Amanchu! 17

4,72 € 5,90 €

Amanchu! Volume: 17 Storia: Kozue Amano Disegni: Kozue Amano Editore: JPOP Lingua: Italiano

Amanchu! 16
  • -20%
  • -20%

Amanchu! 16

4,72 € 5,90 €

Amanchu! Volume: 16 Storia: Kozue Amano Disegni: Kozue Amano Editore: JPOP Lingua: Italiano

Fire Force 10
  • -5%
  • -5%

Fire Force 10

4,66 € 4,90 €

Fire Force  Volume: 10 Storia: Atsushi Ohkubo Disegni: Atsushi Ohkubo Formato: 11.5x17.5 Editore: Planet Manga Lingua: Italiano

AnoHana 1
  • -20%
  • -20%

AnoHana 1

4,72 € 5,90 €

AnoHana Volume: 1 Storia: Mari Okada Disegni: Mitsu Izumi Formato: 12x16.9 Editore: JPOP Lingua: Italiano

Armed Girl's Machiavellism 13
  • -20%
  • -20%

Armed Girl's Machiavellism 13

4,72 € 5,90 €

Armed Girl's Machiavellism Volume: 13 Storia: Yūya Kurokami Disegni: Karuna Kanzaki Formato: 12x16.9 Editore: JPOP Lingua: Italiano

BJ Alex 14
  • -20%
  • -20%

BJ Alex 14

7,92 € 9,90 €

BJ Alex Volumi: 14 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 7
  • -20%
  • -20%

BJ Alex Box 7

15,84 € 19,80 €

BJ Alex Box 7 Volumi: 13 e 14 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 11
  • -20%
  • -20%

BJ Alex 11

7,92 € 9,90 €

BJ Alex Volumi: 11 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 6
  • -20%
  • -20%

BJ Alex Box 6

15,84 € 19,80 €

BJ Alex Box 6 Volumi: 11 e 12 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 10
  • -20%
  • -20%

BJ Alex 10

7,92 € 9,90 €

BJ Alex Volumi: 10 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 9
  • -20%
  • -20%

BJ Alex 9

7,92 € 9,90 €

BJ Alex Volumi: 9 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 5
  • -20%
  • -20%

BJ Alex Box 5

15,84 € 19,80 €

BJ Alex Box 5 Volumi: 9 e 10 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 8
  • -20%
  • -20%

BJ Alex 8

7,92 € 9,90 €

BJ Alex Volumi: 8 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 4
  • -20%
  • -20%

BJ Alex Box 4

15,84 € 19,80 €

BJ Alex Box 4 Volumi: 7 e 8 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 6
  • -20%
  • -20%

BJ Alex 6

7,92 € 9,90 €

BJ Alex Volumi: 6 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 5
  • -20%
  • -20%

BJ Alex 5

7,92 € 9,90 €

BJ Alex Volumi: 5 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex 4
  • -20%
  • -20%

BJ Alex 4

7,92 € 9,90 €

BJ Alex Volumi: 4 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 3
  • -20%
  • -20%

BJ Alex Box 3

15,84 € 19,80 €

BJ Alex Box 3 Volumi: 5 e 6 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 2
  • -20%
  • -20%

BJ Alex Box 2

15,84 € 19,80 €

BJ Alex Box 2 Volumi: 3 e 4 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

BJ Alex Box 1
  • -20%
  • -20%

BJ Alex Box 1

15,84 € 19,80 €

BJ Alex Box 1 Volumi: 1 e 2 Storia: Mingwa Disegni: Mingwa Editore: JPOP Lingua: Italiano

Jujutsu Kaisen 3
  • -5%
  • -5%

Jujutsu Kaisen 3

4,94 € 5,20 €

Jujutsu Kaisen  Volume: 3 Storia: Gege Akutami Disegni: Gege Akutami Formato: 11.5x17.5 Editore: Planet Manga Lingua: Italiano

Caste Heaven 8
  • -20%
  • -20%

Caste Heaven 8

5,52 € 6,90 €

Caste Heaven Volume: 8 Storia: Chise Ogawa Disegni: Chise Ogawa Formato: 12.5x16.9 Editore: JPOP Lingua: Italiano

Torna all'inizio
Load Time 1644 ms
Querying Time 1517 ms
Queries 1133
Memory Peak Usage 30.8 Mb
Included Files 1190 files - 12.41 Mb
PrestaShop Cache - Mb
Global vars 0.38 Mb
PrestaShop Version 8.1.2
PHP Version 8.1.27
MySQL Version 10.5.11-MariaDB-1:10.5.11+maria~buster-log
Memory Limit 512M
Max Execution Time 60s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 1.911 ms 1.911 ms 2.88 Mb 3.2 Mb
__construct 0.010 ms 1.921 ms - Mb 3.2 Mb
init 12.613 ms 14.534 ms 0.50 Mb 3.5 Mb
checkAccess 0.001 ms 14.535 ms - Mb 3.5 Mb
setMedia 2.002 ms 16.537 ms 0.10 Mb 3.5 Mb
postProcess 0.000 ms 16.537 ms - Mb 3.5 Mb
initHeader 0.001 ms 16.538 ms - Mb 3.5 Mb
initContent 1322 ms 1339 ms 11.65 Mb 15.2 Mb
initFooter 0.001 ms 1339 ms - Mb 15.2 Mb
display 305.470 ms 1644 ms 15.02 Mb 30.8 Mb
Hook Time Memory Usage
DisplayHeader 252.589 ms 4.89 Mb
DisplayProductPriceBlock 109.955 ms 6.22 Mb
displayFooter 39.406 ms 1.39 Mb
ActionProductFlagsModifier 27.103 ms 1.73 Mb
displayProductListReviews 23.408 ms 1.74 Mb
Header 20.430 ms 0.37 Mb
displayNav2 14.424 ms 0.41 Mb
DisplayBeforeBodyClosingTag 11.921 ms 0.33 Mb
DisplayMobileMenu 11.018 ms 0.40 Mb
DisplayTop 10.689 ms 0.37 Mb
DisplayFooter 10.458 ms 0.07 Mb
displayLeftColumn 2.023 ms 0.06 Mb
displayCopyrightContainer 1.950 ms 0.09 Mb
displayNav1 1.675 ms 0.11 Mb
displayNavFullWidth 1.267 ms 0.08 Mb
DisplayOverrideTemplate 1.072 ms 0.03 Mb
displayCopyrightContainerLeft 0.934 ms 0.06 Mb
displayBanner 0.889 ms 0.04 Mb
displayTopLeft 0.878 ms 0.04 Mb
displayClientService 0.869 ms 0.06 Mb
DisplayNavFullWidth 0.514 ms 0.03 Mb
displayTopRight 0.164 ms - Mb
ActionFrontControllerSetMedia 0.145 ms 0.01 Mb
DisplayLeftColumn 0.098 ms 0.07 Mb
displayFooterLogo 0.098 ms - Mb
ProductSearchProvider 0.093 ms - Mb
ModuleRoutes 0.007 ms - Mb
27 hook(s) 544.076 ms 18.59 Mb
Module Time Memory Usage
anblog 1.811 ms 0.02 Mb
ps_emailsubscription 1.158 ms 0.08 Mb
ps_socialfollow 0.071 ms 0.01 Mb
ps_emailalerts 0.105 ms 0.01 Mb
ps_shoppingcart 0.933 ms 0.06 Mb
ets_crosssell 29.814 ms 0.18 Mb
ps_searchbar 0.327 ms 0.01 Mb
an_productextratabs 27.233 ms 1.75 Mb
an_client_service 0.960 ms 0.07 Mb
an_trust_badges 2.032 ms 0.09 Mb
an_user_testimonials 0.146 ms 0.01 Mb
an_accordion 0.098 ms 0.01 Mb
an_homeslider 0.152 ms 0.01 Mb
an_homeproducts 0.163 ms 0.01 Mb
an_banners 0.096 ms 0.01 Mb
an_simplefreeshippingline 0.977 ms 0.05 Mb
an_homecategories 0.102 ms 0.07 Mb
paypal 2.081 ms 0.17 Mb
anscrolltop 0.224 ms 0.06 Mb
darkmode 20.339 ms 0.36 Mb
eicaptcha 0.111 ms - Mb
mangayo_assistant 0.111 ms 0.01 Mb
facebookproductad 221.101 ms 4.63 Mb
an_brandslider 10.782 ms 0.14 Mb
an_megamenu 22.032 ms 0.83 Mb
an_productattributes 109.400 ms 6.13 Mb
an_wishlist 24.985 ms 1.84 Mb
an_stickyaddtocart 0.094 ms 0.01 Mb
an_theme 1.208 ms 0.10 Mb
sociallogin 4.527 ms 0.14 Mb
ps_googleanalytics 2.468 ms 0.13 Mb
luminage_mail 0.123 ms 0.01 Mb
hioutofstocknotification 0.436 ms 0.03 Mb
ambjolisearch 17.891 ms 0.26 Mb
hicookielaw 1.374 ms 0.04 Mb
payplug 4.922 ms 0.44 Mb
app_endpoint 0.126 ms 0.01 Mb
codwfeeplus 2.430 ms 0.15 Mb
ps_facetedsearch 0.366 ms 0.13 Mb
ps_languageselector 0.729 ms 0.05 Mb
ps_currencyselector 1.056 ms 0.07 Mb
ps_customersignin 1.011 ms 0.07 Mb
an_logo 1.153 ms 0.05 Mb
ps_categorytree 2.080 ms 0.07 Mb
ps_contactinfo 1.645 ms 0.09 Mb
ps_linklist 25.306 ms 1.02 Mb
ps_customeraccountlinks 3.772 ms 0.18 Mb
an_copyright 1.084 ms 0.06 Mb
statsdata 9.698 ms 0.22 Mb
49 module(s) 560.842 ms 19.91 Mb

Stopwatch SQL - 1133 queries

# Query Time (ms) Rows Filesort Group By Location
389 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=4)) AND ((fp_1.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) GROUP BY fp.id_feature_value
 278.038 ms 71221463040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
385 
SELECT SQL_NO_CACHE p.id_product, sa.out_of_stock FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY IFNULL(p.quantity, 0) <= 0, IFNULL(p.quantity, 0) <= 0 AND FIELD(sa.out_of_stock, 1) DESC, p.position ASC, p.id_product DESC LIMIT 0, 24
 168.913 ms 10062341603328 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
387 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (54, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=3)) AND ((fp_1.id_feature_value IN (54, 46))) GROUP BY fp.id_feature_value
 138.433 ms 51060101120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
386 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46)))
 118.385 ms 17382830080 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
394 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM mangayo_product p INNER JOIN mangayo_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28
 98.714 ms 4672 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
393 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46))) AND cg.id_group='1' AND c.nleft>11 AND c.nright<28 GROUP BY cp.id_category
 34.698 ms 1831424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
2 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `mangayo_configuration` c
LEFT JOIN `mangayo_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 10.574 ms 2039 /classes/Configuration.php:180
13 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `mangayo_module` m
INNER JOIN mangayo_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `mangayo_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `mangayo_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `mangayo_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 7.118 ms 182 Yes Yes /classes/Hook.php:1233
1129 
SELECT SQL_NO_CACHE `id_date_range`, `time_end`
FROM `mangayo_date_range`
WHERE `time_end` = (SELECT MAX(`time_end`) FROM `mangayo_date_range`) LIMIT 1
 6.105 ms 91431844 /classes/DateRange.php:60
728 
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
 5.740 ms 1 /classes/Smarty/SmartyCustom.php:280
79 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `mangayo_hook_module` hm
STRAIGHT_JOIN `mangayo_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `mangayo_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 5.175 ms 610 /classes/Hook.php:456
1107 
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
 5.168 ms 1 /classes/Smarty/SmartyCustom.php:280
65 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-06-28 00:00:00",
INTERVAL 10 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `mangayo_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `mangayo_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `mangayo_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `mangayo_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `mangayo_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 11 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
 3.848 ms 11258 /classes/Category.php:1059
352 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "blocksearch_mod" LIMIT 1
 3.832 ms 0 /classes/module/Module.php:2636
78 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `mangayo_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `mangayo_hook_alias` ha
INNER JOIN `mangayo_hook` h ON ha.name = h.name
 3.763 ms 0 /classes/Hook.php:1292
391 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_1.id_feature_value IN (54, 46))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN mangayo_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=5)) AND ((fp_1.id_feature_value IN (77, 44, 166, 42, 39, 40, 41, 76, 38, 43, 13))) AND ((fp_2.id_feature_value IN (54, 46))) GROUP BY fp.id_feature_value
 3.548 ms 1792 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
5 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `mangayo_lang` l
LEFT JOIN `mangayo_lang_shop` ls ON (l.id_lang = ls.id_lang)
 3.547 ms 1 /classes/Language.php:1080
293 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 3.414 ms 1 /classes/stock/StockAvailable.php:453
1022 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4673
 3.256 ms 3 /classes/Product.php:3423
541 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7361
AND image_shop.`cover` = 1 LIMIT 1
 2.688 ms 3 /classes/Product.php:3570
1021 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4673) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 2.242 ms 1 Yes Yes /classes/Product.php:4504
4 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM mangayo_shop s
LEFT JOIN mangayo_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 2.230 ms 1 /classes/shop/Shop.php:218
540 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7733
ORDER BY f.position ASC
 2.051 ms 7 Yes /classes/Product.php:5993
292 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 303 AND `id_group` = 1 LIMIT 1
 1.976 ms 0 /classes/GroupReduction.php:156
353 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 1.858 ms 0 /classes/module/Module.php:2109
347 
SHOW TABLES LIKE "%mangayo_social_login_%"
 1.853 ms 1 /modules/sociallogin/sociallogin.php:186
12 
SELECT SQL_NO_CACHE lower(name) as name
FROM `mangayo_hook` h
WHERE (h.active = 1)
 1.791 ms 986 /classes/Hook.php:1332
40 
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
 1.646 ms 178 /classes/CartRule.php:418
947 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7361
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.605 ms 2 Yes Yes /classes/Product.php:4578
395 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-06-28 00:00:00',
INTERVAL 10 DAY
)
) > 0) as new
FROM mangayo_product p
LEFT JOIN mangayo_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN mangayo_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN mangayo_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (10978,1987,8192,6857,328,1949,11299,9135,8861,8277,8043,7937,7733,7361,6048,5773,5603,5479,5143,5139,4673,4094,403,6533)
 1.604 ms 24 /classes/ProductAssembler.php:95
1055 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 403
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.593 ms 2 Yes Yes /classes/Product.php:4578
1043 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4094
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.554 ms 2 Yes Yes /classes/Product.php:4578
851 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1949
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.544 ms 2 Yes Yes /classes/Product.php:4578
791 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 10978
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.527 ms 2 Yes Yes /classes/Product.php:4578
803 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1987
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.517 ms 2 Yes Yes /classes/Product.php:4578
839 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 328
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.514 ms 2 Yes Yes /classes/Product.php:4578
1031 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4673
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.500 ms 2 Yes Yes /classes/Product.php:4578
923 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7937
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.499 ms 2 Yes Yes /classes/Product.php:4578
935 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 7733
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.491 ms 2 Yes Yes /classes/Product.php:4578
887 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8861
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.488 ms 2 Yes Yes /classes/Product.php:4578
863 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 11299
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.478 ms 2 Yes Yes /classes/Product.php:4578
1067 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6533
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.472 ms 2 Yes Yes /classes/Product.php:4578
983 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5603
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.469 ms 2 Yes Yes /classes/Product.php:4578
899 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8277
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.467 ms 2 Yes Yes /classes/Product.php:4578
911 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8043
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.463 ms 2 Yes Yes /classes/Product.php:4578
875 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 9135
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.461 ms 2 Yes Yes /classes/Product.php:4578
827 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6857
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.459 ms 2 Yes Yes /classes/Product.php:4578
959 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 6048
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.451 ms 2 Yes Yes /classes/Product.php:4578
1019 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5139
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.449 ms 2 Yes Yes /classes/Product.php:4578
1007 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5143
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.447 ms 2 Yes Yes /classes/Product.php:4578
91 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 285) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.441 ms 2 Yes /classes/SpecificPrice.php:576
815 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8192
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.441 ms 2 Yes Yes /classes/Product.php:4578
995 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5479
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.441 ms 2 Yes Yes /classes/Product.php:4578
971 
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 5773
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
 1.436 ms 2 Yes Yes /classes/Product.php:4578
75 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 284) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.419 ms 2 Yes /classes/SpecificPrice.php:576
58 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
 1.398 ms 40 Yes /classes/Manufacturer.php:211
354 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tmsearch" LIMIT 1
 1.397 ms 0 /classes/module/Module.php:2636
33 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `mangayo_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 11
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 1.389 ms 7 Yes Yes /classes/Category.php:921
234 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 298) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.379 ms 2 Yes /classes/SpecificPrice.php:576
15 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `mangayo_hook`
 1.364 ms 986 /classes/Hook.php:1292
311 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 305) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.360 ms 2 Yes /classes/SpecificPrice.php:576
245 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 299) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.349 ms 2 Yes /classes/SpecificPrice.php:576
350 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "leoproductsearch" LIMIT 1
 1.325 ms 0 /classes/module/Module.php:2636
1132 
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `mangayo_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (10978,1987,8192,6857,328,1949,11299,9135,8861,8277,8043,7937,7733,7361,6048,5773,5603,5479,5143,5139,4673,4094,403,6533) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
 1.303 ms 73 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
146 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 290) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.284 ms 2 Yes /classes/SpecificPrice.php:576
190 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 294) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.277 ms 2 Yes /classes/SpecificPrice.php:576
289 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 303) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.276 ms 2 Yes /classes/SpecificPrice.php:576
212 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 296) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.260 ms 2 Yes /classes/SpecificPrice.php:576
102 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 286) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.257 ms 2 Yes /classes/SpecificPrice.php:576
1094 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 8 AND `id_shop` = 1
 1.255 ms 1 /src/Adapter/EntityMapper.php:79
1088 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 3 AND `id_shop` = 1
 1.255 ms 1 /src/Adapter/EntityMapper.php:79
113 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 287) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.246 ms 2 Yes /classes/SpecificPrice.php:576
157 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 291) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.220 ms 2 Yes /classes/SpecificPrice.php:576
278 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 302) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.216 ms 2 Yes /classes/SpecificPrice.php:576
267 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 301) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.212 ms 2 Yes /classes/SpecificPrice.php:576
201 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 295) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.211 ms 2 Yes /classes/SpecificPrice.php:576
179 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 293) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.204 ms 2 Yes /classes/SpecificPrice.php:576
135 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 289) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.193 ms 2 Yes /classes/SpecificPrice.php:576
168 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 292) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.177 ms 2 Yes /classes/SpecificPrice.php:576
256 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 300) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.174 ms 2 Yes /classes/SpecificPrice.php:576
124 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 288) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.152 ms 2 Yes /classes/SpecificPrice.php:576
223 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 297) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.138 ms 2 Yes /classes/SpecificPrice.php:576
322 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 306) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.129 ms 2 Yes /classes/SpecificPrice.php:576
384 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
 1.122 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
300 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 304) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.108 ms 2 Yes /classes/SpecificPrice.php:576
185 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 293
ORDER BY f.position ASC
 1.105 ms 7 Yes /classes/Product.php:5993
129 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 288 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 288 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.094 ms 0 /classes/Cart.php:1410
84 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 284 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.089 ms 0 /classes/Cart.php:1410
118 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 287 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.084 ms 0 /classes/Cart.php:1410
195 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 294 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 294 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.079 ms 0 /classes/Cart.php:1410
333 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 307) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.072 ms 2 Yes /classes/SpecificPrice.php:576
1096 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 9 AND `id_shop` = 1
 1.060 ms 1 /src/Adapter/EntityMapper.php:79
173 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 292 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 292 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.054 ms 0 /classes/Cart.php:1410
261 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 300 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 300 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.053 ms 0 /classes/Cart.php:1410
177 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 293) AND (b.`id_shop` = 1) LIMIT 1
 1.040 ms 1 /src/Adapter/EntityMapper.php:71
1070 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
 1.036 ms 40 Yes /classes/Manufacturer.php:211
206 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 295 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.031 ms 0 /classes/Cart.php:1410
239 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 298 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.027 ms 0 /classes/Cart.php:1410
752 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
 1.027 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
184 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 293 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.027 ms 0 /classes/Cart.php:1410
207 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 295
ORDER BY f.position ASC
 1.023 ms 7 Yes /classes/Product.php:5993
151 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 290 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 290 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.015 ms 0 /classes/Cart.php:1410
96 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 285 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.014 ms 0 /classes/Cart.php:1410
374 
SELECT SQL_NO_CACHE t.*,
tl.*
FROM `mangayo_hicookietype` t
LEFT JOIN `mangayo_hicookietype_lang` `tl` ON t.`id_type` = tl.`id_type`
LEFT JOIN `mangayo_hicookietype_shop` `ts` ON t.`id_type` = ts.`id_type`
WHERE (tl.`id_lang` = 1) AND (ts.`id_shop` = 1)
ORDER BY t.position
 1.008 ms 9 Yes /modules/hicookielaw/classes/type.php:68
262 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 300
ORDER BY f.position ASC
 1.003 ms 7 Yes /classes/Product.php:5993
294 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 303 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.000 ms 0 /classes/Cart.php:1410
228 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 297 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.993 ms 0 /classes/Cart.php:1410
162 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 291 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 291 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.991 ms 0 /classes/Cart.php:1410
163 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 291
ORDER BY f.position ASC
 0.990 ms 7 Yes /classes/Product.php:5993
140 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 289 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 289 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.983 ms 0 /classes/Cart.php:1410
272 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 301 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 301 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.976 ms 0 /classes/Cart.php:1410
141 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 289
ORDER BY f.position ASC
 0.972 ms 7 Yes /classes/Product.php:5993
217 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 296 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.966 ms 0 /classes/Cart.php:1410
130 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 288
ORDER BY f.position ASC
 0.966 ms 7 Yes /classes/Product.php:5993
283 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 302 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.964 ms 0 /classes/Cart.php:1410
778 
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `mangayo_category` c
INNER JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `mangayo_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 6
AND nleft >= 11 AND nright <= 28
AND c.id_category IN (
SELECT id_category
FROM `mangayo_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cs.`position` ASC
 0.962 ms 9 Yes /modules/ps_categorytree/ps_categorytree.php:166
316 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 305 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.942 ms 0 /classes/Cart.php:1410
250 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 299 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.941 ms 0 /classes/Cart.php:1410
767 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
 0.938 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
37 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.925 ms 130 /classes/module/Module.php:345
210 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 296) AND (b.`id_shop` = 1) LIMIT 1
 0.924 ms 1 /src/Adapter/EntityMapper.php:71
107 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 286 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.923 ms 0 /classes/Cart.php:1410
39 
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.919 ms 465 /classes/CartRule.php:357
89 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 285) AND (b.`id_shop` = 1) LIMIT 1
 0.918 ms 1 /src/Adapter/EntityMapper.php:71
298 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 304) AND (b.`id_shop` = 1) LIMIT 1
 0.916 ms 1 /src/Adapter/EntityMapper.php:71
284 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 302
ORDER BY f.position ASC
 0.914 ms 7 Yes /classes/Product.php:5993
196 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 294
ORDER BY f.position ASC
 0.908 ms 7 Yes /classes/Product.php:5993
265 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 301) AND (b.`id_shop` = 1) LIMIT 1
 0.897 ms 1 /src/Adapter/EntityMapper.php:71
287 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 303) AND (b.`id_shop` = 1) LIMIT 1
 0.897 ms 1 /src/Adapter/EntityMapper.php:71
221 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 297) AND (b.`id_shop` = 1) LIMIT 1
 0.895 ms 1 /src/Adapter/EntityMapper.php:71
317 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 305
ORDER BY f.position ASC
 0.895 ms 7 Yes /classes/Product.php:5993
338 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 307 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.894 ms 0 /classes/Cart.php:1410
295 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 303
ORDER BY f.position ASC
 0.889 ms 7 Yes /classes/Product.php:5993
327 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 306 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.889 ms 0 /classes/Cart.php:1410
305 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 304 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.886 ms 0 /classes/Cart.php:1410
218 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 296
ORDER BY f.position ASC
 0.879 ms 7 Yes /classes/Product.php:5993
382 
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `mangayo_feature` f  INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `mangayo_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `mangayo_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
 0.878 ms 49 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
85 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 284
ORDER BY f.position ASC
 0.876 ms 7 Yes /classes/Product.php:5993
229 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 297
ORDER BY f.position ASC
 0.872 ms 7 Yes /classes/Product.php:5993
119 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 287
ORDER BY f.position ASC
 0.870 ms 7 Yes /classes/Product.php:5993
174 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 292
ORDER BY f.position ASC
 0.865 ms 7 Yes /classes/Product.php:5993
251 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 299
ORDER BY f.position ASC
 0.860 ms 7 Yes /classes/Product.php:5993
16 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.858 ms 130 /classes/module/Module.php:345
155 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 291) AND (b.`id_shop` = 1) LIMIT 1
 0.858 ms 1 /src/Adapter/EntityMapper.php:71
199 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 295) AND (b.`id_shop` = 1) LIMIT 1
 0.857 ms 1 /src/Adapter/EntityMapper.php:71
273 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 301
ORDER BY f.position ASC
 0.851 ms 7 Yes /classes/Product.php:5993
763 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.851 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
240 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 298
ORDER BY f.position ASC
 0.848 ms 7 Yes /classes/Product.php:5993
152 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 290
ORDER BY f.position ASC
 0.843 ms 7 Yes /classes/Product.php:5993
97 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 285
ORDER BY f.position ASC
 0.842 ms 7 Yes /classes/Product.php:5993
59 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`, cl.`link_rewrite`, category_shop.`id_shop`
FROM `mangayo_category` c
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE `id_lang` = 1
AND c.`id_parent` = 2
AND `active` = 1
GROUP BY c.`id_category`
ORDER BY category_shop.`position` ASC
 0.841 ms 15 Yes Yes /classes/Category.php:1148
108 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 286
ORDER BY f.position ASC
 0.839 ms 7 Yes /classes/Product.php:5993
309 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 305) AND (b.`id_shop` = 1) LIMIT 1
 0.839 ms 1 /src/Adapter/EntityMapper.php:71
769 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.838 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
122 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 288) AND (b.`id_shop` = 1) LIMIT 1
 0.837 ms 1 /src/Adapter/EntityMapper.php:71
306 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 304
ORDER BY f.position ASC
 0.836 ms 7 Yes /classes/Product.php:5993
188 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 294) AND (b.`id_shop` = 1) LIMIT 1
 0.833 ms 1 /src/Adapter/EntityMapper.php:71
232 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 298) AND (b.`id_shop` = 1) LIMIT 1
 0.832 ms 1 /src/Adapter/EntityMapper.php:71
133 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 289) AND (b.`id_shop` = 1) LIMIT 1
 0.831 ms 1 /src/Adapter/EntityMapper.php:71
144 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 290) AND (b.`id_shop` = 1) LIMIT 1
 0.831 ms 1 /src/Adapter/EntityMapper.php:71
276 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 302) AND (b.`id_shop` = 1) LIMIT 1
 0.828 ms 1 /src/Adapter/EntityMapper.php:71
18 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `mangayo_meta` m
LEFT JOIN `mangayo_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.822 ms 59 Yes /classes/Dispatcher.php:654
560 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.822 ms 1 /classes/stock/StockAvailable.php:453
254 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 300) AND (b.`id_shop` = 1) LIMIT 1
 0.822 ms 1 /src/Adapter/EntityMapper.php:71
111 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 287) AND (b.`id_shop` = 1) LIMIT 1
 0.821 ms 1 /src/Adapter/EntityMapper.php:71
69 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 284) AND (b.`id_shop` = 1) LIMIT 1
 0.820 ms 1 /src/Adapter/EntityMapper.php:71
41 
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.819 ms 465 /classes/CartRule.php:357
589 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5479) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.817 ms 3 Yes /classes/SpecificPrice.php:576
768 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.814 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
567 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5773) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.813 ms 3 Yes /classes/SpecificPrice.php:576
1009 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5139) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.813 ms 1 Yes Yes /classes/Product.php:4504
328 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 306
ORDER BY f.position ASC
 0.805 ms 7 Yes /classes/Product.php:5993
633 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4094) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.804 ms 2 Yes /classes/SpecificPrice.php:576
166 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 292) AND (b.`id_shop` = 1) LIMIT 1
 0.798 ms 1 /src/Adapter/EntityMapper.php:71
339 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 307
ORDER BY f.position ASC
 0.798 ms 7 Yes /classes/Product.php:5993
334 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 307)
 0.796 ms 1 /classes/Product.php:3857
100 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 286) AND (b.`id_shop` = 1) LIMIT 1
 0.794 ms 1 /src/Adapter/EntityMapper.php:71
434 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6857) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.787 ms 3 Yes /classes/SpecificPrice.php:576
479 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 9135) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.785 ms 3 Yes /classes/SpecificPrice.php:576
383 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
 0.782 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
243 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 299) AND (b.`id_shop` = 1) LIMIT 1
 0.781 ms 1 /src/Adapter/EntityMapper.php:71
753 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.777 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
423 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8192) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.772 ms 3 Yes /classes/SpecificPrice.php:576
180 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 293)
 0.770 ms 1 /classes/Product.php:3857
766 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.759 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
331 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 307) AND (b.`id_shop` = 1) LIMIT 1
 0.757 ms 1 /src/Adapter/EntityMapper.php:71
42 
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
 0.752 ms 1 /classes/CartRule.php:418
320 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 306) AND (b.`id_shop` = 1) LIMIT 1
 0.751 ms 1 /src/Adapter/EntityMapper.php:71
401 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 10978) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.749 ms 3 Yes /classes/SpecificPrice.php:576
390 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
 0.745 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
545 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7361) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.744 ms 3 Yes /classes/SpecificPrice.php:576
747 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.735 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
158 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 291)
 0.729 ms 1 /classes/Product.php:3857
762 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.727 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
748 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.723 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
412 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1987) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.717 ms 3 Yes /classes/SpecificPrice.php:576
369 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.717 ms 0 /classes/module/Module.php:2109
751 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.712 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
750 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.711 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
949 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.711 ms 1 Yes Yes /classes/Product.php:4504
468 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 11299) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.709 ms 2 Yes /classes/SpecificPrice.php:576
793 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1987) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.709 ms 1 Yes Yes /classes/Product.php:4504
611 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5139) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.706 ms 3 Yes /classes/SpecificPrice.php:576
1 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM mangayo_shop_group gs
LEFT JOIN mangayo_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN mangayo_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.705 ms 1 Yes /classes/shop/Shop.php:715
76 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 284)
 0.705 ms 1 /classes/Product.php:3857
103 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 286)
 0.704 ms 1 /classes/Product.php:3857
377 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12211) LIMIT 1
 0.700 ms 1 /src/Adapter/EntityMapper.php:71
512 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8043) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.699 ms 3 Yes /classes/SpecificPrice.php:576
655 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6533) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.699 ms 3 Yes /classes/SpecificPrice.php:576
125 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 288)
 0.695 ms 1 /classes/Product.php:3857
746 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.693 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
534 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7733) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.689 ms 3 Yes /classes/SpecificPrice.php:576
1100 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 11 AND `id_shop` = 1
 0.689 ms 1 /src/Adapter/EntityMapper.php:79
622 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4673) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.688 ms 3 Yes /classes/SpecificPrice.php:576
600 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5143) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.684 ms 3 Yes /classes/SpecificPrice.php:576
169 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 292)
 0.683 ms 1 /classes/Product.php:3857
457 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1949) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.682 ms 3 Yes /classes/SpecificPrice.php:576
523 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 7937) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.682 ms 3 Yes /classes/SpecificPrice.php:576
501 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8277) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.682 ms 3 Yes /classes/SpecificPrice.php:576
644 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 403) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.682 ms 2 Yes /classes/SpecificPrice.php:576
235 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 298)
 0.680 ms 1 /classes/Product.php:3857
573 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5773
ORDER BY f.position ASC
 0.677 ms 7 Yes /classes/Product.php:5993
1023 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4673)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.675 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
765 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.673 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
224 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 297)
 0.672 ms 1 /classes/Product.php:3857
761 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.672 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
114 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 287)
 0.665 ms 1 /classes/Product.php:3857
290 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 303)
 0.664 ms 1 /classes/Product.php:3857
307 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 305
AND image_shop.`cover` = 1 LIMIT 1
 0.663 ms 1 /classes/Product.php:3570
754 
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
 0.662 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
344 
SELECT SQL_NO_CACHE c.id_category, cl.name, cl.link_rewrite FROM mangayo_category c LEFT JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN mangayo_category_lang cl ON (cl.id_category = c.id_category AND cl.id_shop = 1 )WHERE c.nleft <= 11 AND c.nright >= 28 AND c.nleft >= 2 AND c.nright <= 173 AND cl.id_lang = 1 AND c.level_depth > 1 ORDER BY c.level_depth ASC
 0.661 ms 6 Yes /modules/facebookproductad/lib/moduleTools.php:526
392 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
 0.659 ms 87 Yes /classes/Category.php:721
466 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 11299) AND (b.`id_shop` = 1) LIMIT 1
 0.658 ms 1 /src/Adapter/EntityMapper.php:71
578 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5603) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.657 ms 3 Yes /classes/SpecificPrice.php:576
490 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8861) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.656 ms 3 Yes /classes/SpecificPrice.php:576
556 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6048) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.654 ms 3 Yes /classes/SpecificPrice.php:576
627 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4673 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4673 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.652 ms 0 /classes/Cart.php:1410
583 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5603 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5603 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.651 ms 0 /classes/Cart.php:1410
14 
SELECT SQL_NO_CACHE `name`, `alias` FROM `mangayo_hook_alias`
 0.650 ms 88 /classes/Hook.php:287
446 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 328) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.649 ms 2 Yes /classes/SpecificPrice.php:576
34 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 88) AND (b.`id_shop` = 1) LIMIT 1
 0.647 ms 1 /src/Adapter/EntityMapper.php:71
246 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 299)
 0.647 ms 1 /classes/Product.php:3857
901 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.644 ms 1 Yes Yes /classes/Product.php:4504
605 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5143 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5143 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.643 ms 0 /classes/Cart.php:1410
213 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 296)
 0.641 ms 1 /classes/Product.php:3857
342 
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 11) LIMIT 1
 0.639 ms 1 /classes/Category.php:1971
0 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM mangayo_shop_url su
LEFT JOIN mangayo_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'mangayo.it' OR su.domain_ssl = 'mangayo.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.639 ms 1 Yes /classes/shop/Shop.php:1364
123 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 288
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.635 ms 1 /classes/SpecificPrice.php:259
889 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8277) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.635 ms 1 Yes Yes /classes/Product.php:4504
66 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 284
AND image_shop.`cover` = 1 LIMIT 1
 0.633 ms 1 /classes/Product.php:3570
913 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7937) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.633 ms 1 Yes Yes /classes/Product.php:4504
961 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5773) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.633 ms 1 Yes Yes /classes/Product.php:4504
829 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (328) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.631 ms 1 Yes Yes /classes/Product.php:4504
87 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 285
AND image_shop.`cover` = 1 LIMIT 1
 0.630 ms 1 /classes/Product.php:3570
877 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8861) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.630 ms 1 Yes Yes /classes/Product.php:4504
208 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 296
AND image_shop.`cover` = 1 LIMIT 1
 0.626 ms 1 /classes/Product.php:3570
925 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7733) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.624 ms 1 Yes Yes /classes/Product.php:4504
660 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6533 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6533 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.624 ms 0 /classes/Cart.php:1410
92 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 285)
 0.623 ms 1 /classes/Product.php:3857
1127 
INSERT IGNORE INTO `mangayo_connections_page` (`id_connections`, `id_page`, `time_start`) VALUES ('7334450', '48', '2024-06-28 13:07:53')
 0.623 ms 1 /classes/Connection.php:122
781 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10978) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.622 ms 1 Yes Yes /classes/Product.php:4504
381 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM mangayo_layered_category
WHERE controller = 'category'
AND id_category = 11
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.622 ms 6 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
6 
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
 0.621 ms 1 /src/Adapter/EntityMapper.php:71
451 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 328 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 328 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.621 ms 0 /classes/Cart.php:1410
38 
SELECT SQL_NO_CACHE 1 FROM mangayo_cart_product cp INNER JOIN mangayo_product p
ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
 0.620 ms 1 /classes/Cart.php:4192
934 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7733
ORDER BY `position`
 0.619 ms 1 Yes /classes/Product.php:3545
817 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6857) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.619 ms 1 Yes Yes /classes/Product.php:4504
572 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5773 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5773 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.618 ms 0 /classes/Cart.php:1410
891 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8277)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.617 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
194 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 294) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.616 ms 1 /classes/stock/StockAvailable.php:453
997 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5143) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.615 ms 1 Yes Yes /classes/Product.php:4504
865 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (9135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.614 ms 1 Yes Yes /classes/Product.php:4504
973 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5603) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.612 ms 1 Yes Yes /classes/Product.php:4504
52 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a0
LEFT JOIN `mangayo_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 11) AND (a0.`nright` > 28) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.611 ms 6 /classes/PrestaShopCollection.php:383
428 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8192 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8192 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.610 ms 0 /classes/Cart.php:1410
937 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (7361) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.610 ms 1 Yes Yes /classes/Product.php:4504
561 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6048 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.609 ms 0 /classes/Cart.php:1410
499 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8277) AND (b.`id_shop` = 1) LIMIT 1
 0.609 ms 1 /src/Adapter/EntityMapper.php:71
257 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 300)
 0.608 ms 1 /classes/Product.php:3857
594 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5479 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5479 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.608 ms 0 /classes/Cart.php:1410
805 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8192) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.607 ms 1 Yes Yes /classes/Product.php:4504
388 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
 0.605 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
477 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 9135) AND (b.`id_shop` = 1) LIMIT 1
 0.605 ms 1 /src/Adapter/EntityMapper.php:71
202 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 295)
 0.602 ms 1 /classes/Product.php:3857
439 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6857 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6857 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.598 ms 0 /classes/Cart.php:1410
19 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
 0.597 ms 1 /src/Adapter/EntityMapper.php:71
1033 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4094) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.597 ms 1 Yes Yes /classes/Product.php:4504
301 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 304)
 0.596 ms 1 /classes/Product.php:3857
136 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 289)
 0.596 ms 1 /classes/Product.php:3857
462 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1949 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1949 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.595 ms 0 /classes/Cart.php:1410
853 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (11299) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.594 ms 1 Yes Yes /classes/Product.php:4504
406 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10978 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10978 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.592 ms 0 /classes/Cart.php:1410
985 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5479) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.592 ms 1 Yes Yes /classes/Product.php:4504
191 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 294)
 0.591 ms 1 /classes/Product.php:3857
1057 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6533) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.591 ms 1 Yes Yes /classes/Product.php:4504
1045 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (403) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.590 ms 1 Yes Yes /classes/Product.php:4504
473 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 11299 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 11299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.589 ms 0 /classes/Cart.php:1410
841 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1949) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.589 ms 1 Yes Yes /classes/Product.php:4504
263 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 301
AND image_shop.`cover` = 1 LIMIT 1
 0.588 ms 1 /classes/Product.php:3570
543 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7361) AND (b.`id_shop` = 1) LIMIT 1
 0.587 ms 1 /src/Adapter/EntityMapper.php:71
819 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6857)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.587 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
927 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7733)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.587 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
606 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5143
ORDER BY f.position ASC
 0.586 ms 7 Yes /classes/Product.php:5993
1077 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572873))
 0.586 ms 1 /classes/Smarty/SmartyCustom.php:265
507 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8277
ORDER BY f.position ASC
 0.584 ms 7 Yes /classes/Product.php:5993
443 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 328) AND (b.`id_shop` = 1) LIMIT 1
 0.583 ms 1 /src/Adapter/EntityMapper.php:71
417 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1987 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1987 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.582 ms 0 /classes/Cart.php:1410
268 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 301)
 0.581 ms 1 /classes/Product.php:3857
279 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 302)
 0.581 ms 1 /classes/Product.php:3857
517 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8043 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.581 ms 0 /classes/Cart.php:1410
587 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5479) AND (b.`id_shop` = 1) LIMIT 1
 0.581 ms 1 /src/Adapter/EntityMapper.php:71
642 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 403) AND (b.`id_shop` = 1) LIMIT 1
 0.581 ms 1 /src/Adapter/EntityMapper.php:71
506 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8277 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8277 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.580 ms 0 /classes/Cart.php:1410
903 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8043)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.580 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
147 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 290)
 0.579 ms 1 /classes/Product.php:3857
616 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5139 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.579 ms 0 /classes/Cart.php:1410
745 
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
 0.579 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
912 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8043
 0.579 ms 1 /classes/Product.php:2902
1066 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6533
ORDER BY `position`
 0.579 ms 1 Yes /classes/Product.php:3545
638 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4094 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4094 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.577 ms 0 /classes/Cart.php:1410
70 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE id_product = 0 LIMIT 1
 0.577 ms 1 /classes/SpecificPrice.php:426
982 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5603
ORDER BY `position`
 0.577 ms 1 Yes /classes/Product.php:3545
197 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 295
AND image_shop.`cover` = 1 LIMIT 1
 0.576 ms 1 /classes/Product.php:3570
550 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7361 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7361 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.575 ms 0 /classes/Cart.php:1410
341 
SELECT SQL_NO_CACHE *
FROM `mangayo_category_lang`
WHERE `id_category` = 11 AND `id_shop` = 1
 0.575 ms 1 /src/Adapter/EntityMapper.php:79
653 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6533) AND (b.`id_shop` = 1) LIMIT 1
 0.574 ms 1 /src/Adapter/EntityMapper.php:71
760 
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
 0.574 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
312 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 305)
 0.572 ms 1 /classes/Product.php:3857
1120 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_trust_badges" LIMIT 1
 0.572 ms 1 /classes/module/Module.php:2636
421 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8192) AND (b.`id_shop` = 1) LIMIT 1
 0.571 ms 1 /src/Adapter/EntityMapper.php:71
432 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6857) AND (b.`id_shop` = 1) LIMIT 1
 0.571 ms 1 /src/Adapter/EntityMapper.php:71
484 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 9135 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 9135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.571 ms 0 /classes/Cart.php:1410
948 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7361
 0.571 ms 1 /classes/Product.php:2902
970 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5773
ORDER BY `position`
 0.571 ms 1 Yes /classes/Product.php:3545
120 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 288
AND image_shop.`cover` = 1 LIMIT 1
 0.571 ms 1 /classes/Product.php:3570
175 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 293
AND image_shop.`cover` = 1 LIMIT 1
 0.569 ms 1 /classes/Product.php:3570
609 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5139) AND (b.`id_shop` = 1) LIMIT 1
 0.569 ms 1 /src/Adapter/EntityMapper.php:71
346 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 14 LIMIT 1
 0.567 ms 1 /classes/Hook.php:244
407 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10978
ORDER BY f.position ASC
 0.567 ms 7 Yes /classes/Product.php:5993
238 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.567 ms 1 /classes/stock/StockAvailable.php:453
551 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7361
ORDER BY f.position ASC
 0.567 ms 7 Yes /classes/Product.php:5993
1006 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5143
ORDER BY `position`
 0.567 ms 1 Yes /classes/Product.php:3545
554 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6048) AND (b.`id_shop` = 1) LIMIT 1
 0.566 ms 1 /src/Adapter/EntityMapper.php:71
783 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88, 101)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 10978)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.566 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1011 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5139)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.566 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
510 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8043) AND (b.`id_shop` = 1) LIMIT 1
 0.563 ms 1 /src/Adapter/EntityMapper.php:71
532 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7733) AND (b.`id_shop` = 1) LIMIT 1
 0.563 ms 1 /src/Adapter/EntityMapper.php:71
440 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6857
ORDER BY f.position ASC
 0.563 ms 7 Yes /classes/Product.php:5993
528 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7937 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7937 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.563 ms 0 /classes/Cart.php:1410
495 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8861 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8861 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.562 ms 0 /classes/Cart.php:1410
915 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7937)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.562 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
598 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5143) AND (b.`id_shop` = 1) LIMIT 1
 0.561 ms 1 /src/Adapter/EntityMapper.php:71
35 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 90) AND (b.`id_shop` = 1) LIMIT 1
 0.560 ms 1 /src/Adapter/EntityMapper.php:71
546 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7361)
 0.560 ms 1 /classes/Product.php:3857
1090 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 1 AND `id_shop` = 1
 0.560 ms 1 /src/Adapter/EntityMapper.php:79
142 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 290
AND image_shop.`cover` = 1 LIMIT 1
 0.560 ms 1 /classes/Product.php:3570
98 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 286
AND image_shop.`cover` = 1 LIMIT 1
 0.559 ms 1 /classes/Product.php:3570
241 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 299
AND image_shop.`cover` = 1 LIMIT 1
 0.559 ms 1 /classes/Product.php:3570
539 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 7733 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 7733 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.559 ms 0 /classes/Cart.php:1410
86 
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.559 ms 0 /classes/tax/TaxRulesTaxManager.php:109
565 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5773) AND (b.`id_shop` = 1) LIMIT 1
 0.559 ms 1 /src/Adapter/EntityMapper.php:71
131 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 289
AND image_shop.`cover` = 1 LIMIT 1
 0.558 ms 1 /classes/Product.php:3570
410 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1987) AND (b.`id_shop` = 1) LIMIT 1
 0.558 ms 1 /src/Adapter/EntityMapper.php:71
464 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 11299
AND image_shop.`cover` = 1 LIMIT 1
 0.558 ms 1 /classes/Product.php:3570
398 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10978) AND (b.`id_shop` = 1) LIMIT 1
 0.558 ms 1 /src/Adapter/EntityMapper.php:71
109 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 287
AND image_shop.`cover` = 1 LIMIT 1
 0.557 ms 1 /classes/Product.php:3570
274 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 302
AND image_shop.`cover` = 1 LIMIT 1
 0.555 ms 1 /classes/Product.php:3570
951 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6048)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.555 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
576 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5603) AND (b.`id_shop` = 1) LIMIT 1
 0.554 ms 1 /src/Adapter/EntityMapper.php:71
20 
SELECT SQL_NO_CACHE * FROM `mangayo_currency` c ORDER BY `iso_code` ASC
 0.553 ms 1 Yes /classes/Currency.php:709
296 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 304
AND image_shop.`cover` = 1 LIMIT 1
 0.552 ms 1 /classes/Product.php:3570
939 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 7361)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.551 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
323 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 306)
 0.549 ms 1 /classes/Product.php:3857
329 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 307
AND image_shop.`cover` = 1 LIMIT 1
 0.548 ms 1 /classes/Product.php:3570
649 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 403 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 403 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.548 ms 0 /classes/Cart.php:1410
910 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8043
ORDER BY `position`
 0.548 ms 3 Yes /classes/Product.php:3545
452 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 328
ORDER BY f.position ASC
 0.547 ms 7 Yes /classes/Product.php:5993
80 
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 211)
AND ('00133' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '00133')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.546 ms 0 /classes/tax/TaxRulesTaxManager.php:109
429 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8192
ORDER BY f.position ASC
 0.546 ms 7 Yes /classes/Product.php:5993
64 
SELECT SQL_NO_CACHE id_order
FROM `mangayo_orders` o
WHERE (o.id_cart=0) LIMIT 1
 0.545 ms 1 /modules/facebookproductad/lib/dao/moduleDao.php:383
71 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.545 ms 8769 /classes/SpecificPrice.php:297
219 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 297
AND image_shop.`cover` = 1 LIMIT 1
 0.545 ms 1 /classes/Product.php:3570
631 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4094) AND (b.`id_shop` = 1) LIMIT 1
 0.545 ms 1 /src/Adapter/EntityMapper.php:71
867 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 9135)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.545 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
898 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8277
ORDER BY `position`
 0.545 ms 1 Yes /classes/Product.php:3545
1061 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6533 LIMIT 1
 0.545 ms 8 /modules/an_wishlist/classes/an_wish_products.php:124
474 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 11299
ORDER BY f.position ASC
 0.544 ms 7 Yes /classes/Product.php:5993
595 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5479
ORDER BY f.position ASC
 0.544 ms 7 Yes /classes/Product.php:5993
252 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 300
AND image_shop.`cover` = 1 LIMIT 1
 0.543 ms 1 /classes/Product.php:3570
703 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4673
ORDER BY `position`
 0.543 ms 1 Yes /classes/Product.php:3545
488 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8861) AND (b.`id_shop` = 1) LIMIT 1
 0.542 ms 1 /src/Adapter/EntityMapper.php:71
485 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 9135
ORDER BY f.position ASC
 0.542 ms 7 Yes /classes/Product.php:5993
617 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5139
ORDER BY f.position ASC
 0.541 ms 7 Yes /classes/Product.php:5993
975 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5603)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.540 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
455 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1949) AND (b.`id_shop` = 1) LIMIT 1
 0.539 ms 1 /src/Adapter/EntityMapper.php:71
1049 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 403 LIMIT 1
 0.539 ms 227 /modules/an_wishlist/classes/an_wish_products.php:124
521 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 7937) AND (b.`id_shop` = 1) LIMIT 1
 0.539 ms 1 /src/Adapter/EntityMapper.php:71
620 
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4673) AND (b.`id_shop` = 1) LIMIT 1
 0.538 ms 1 /src/Adapter/EntityMapper.php:71
987 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5479)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.537 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
164 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 292
AND image_shop.`cover` = 1 LIMIT 1
 0.536 ms 1 /classes/Product.php:3570
463 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1949
ORDER BY f.position ASC
 0.536 ms 7 Yes /classes/Product.php:5993
153 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 291
AND image_shop.`cover` = 1 LIMIT 1
 0.535 ms 1 /classes/Product.php:3570
318 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 306
AND image_shop.`cover` = 1 LIMIT 1
 0.534 ms 1 /classes/Product.php:3570
807 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8192)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.534 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
518 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8043
ORDER BY f.position ASC
 0.533 ms 7 Yes /classes/Product.php:5993
584 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5603
ORDER BY f.position ASC
 0.533 ms 7 Yes /classes/Product.php:5993
340 
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) LIMIT 1
 0.532 ms 1 /src/Adapter/EntityMapper.php:71
568 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5773)
 0.532 ms 1 /classes/Product.php:3857
230 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 298
AND image_shop.`cover` = 1 LIMIT 1
 0.531 ms 1 /classes/Product.php:3570
1035 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4094)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.530 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
24 
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.529 ms 1 /src/Adapter/EntityMapper.php:71
336 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 307 AND `id_group` = 1 LIMIT 1
 0.529 ms 0 /classes/GroupReduction.php:156
958 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6048
ORDER BY `position`
 0.529 ms 1 Yes /classes/Product.php:3545
999 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5143)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.529 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
661 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6533
ORDER BY f.position ASC
 0.528 ms 7 Yes /classes/Product.php:5993
524 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7937)
 0.527 ms 1 /classes/Product.php:3857
795 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88, 90, 101)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1987)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.527 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
94 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 285 AND `id_group` = 1 LIMIT 1
 0.526 ms 0 /classes/GroupReduction.php:156
782 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 10978
 0.526 ms 4 /classes/Product.php:3423
67 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 11 LIMIT 1
 0.524 ms 1 /classes/Category.php:1375
186 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 294
AND image_shop.`cover` = 1 LIMIT 1
 0.524 ms 1 /classes/Product.php:3570
855 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 11299)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.522 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1110 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php'
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme"
 0.521 ms 1 /classes/Smarty/SmartyCustom.php:184
963 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 5773)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.521 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
843 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1949)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.520 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
134 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 289
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.518 ms 1 /classes/SpecificPrice.php:259
972 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5773
 0.518 ms 1 /classes/Product.php:2902
288 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.517 ms 1 /classes/SpecificPrice.php:259
491 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8861)
 0.517 ms 1 /classes/Product.php:3857
529 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 7937
ORDER BY f.position ASC
 0.517 ms 7 Yes /classes/Product.php:5993
579 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5603)
 0.517 ms 1 /classes/Product.php:3857
628 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4673
ORDER BY f.position ASC
 0.517 ms 7 Yes /classes/Product.php:5993
650 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 403
ORDER BY f.position ASC
 0.516 ms 7 Yes /classes/Product.php:5993
496 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8861
ORDER BY f.position ASC
 0.516 ms 7 Yes /classes/Product.php:5993
957 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6048 LIMIT 1
 0.516 ms 1 /classes/Product.php:1106
879 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8861)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.515 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
922 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7937
ORDER BY `position`
 0.514 ms 1 Yes /classes/Product.php:3545
1047 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 403)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.513 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1128 
INSERT INTO `mangayo_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('7334450', '', 'mangayo.it/11-manga?q=Categoria+-Art+Book-Boys+love-Character+Book-Hentai-Josei-Manhua-Manhwa-Novel-Shoujo-Shoujo%5C-Ai-Shounen%2FGenere-Ecchi-Scolastico', '', '2024-06-28 13:07:53')
 0.512 ms 1 /classes/ObjectModel.php:622
831 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 328)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.512 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
790 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10978
ORDER BY `position`
 0.511 ms 1 Yes /classes/Product.php:3545
17 
SELECT SQL_NO_CACHE name, alias FROM `mangayo_hook_alias`
 0.509 ms 88 /classes/Hook.php:339
418 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1987
ORDER BY f.position ASC
 0.509 ms 7 Yes /classes/Product.php:5993
946 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7361
ORDER BY `position`
 0.509 ms 3 Yes /classes/Product.php:3545
994 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5479
ORDER BY `position`
 0.509 ms 1 Yes /classes/Product.php:3545
46 
SELECT SQL_NO_CACHE format
FROM `mangayo_address_format`
WHERE `id_country` = 10 LIMIT 1
 0.508 ms 1 /classes/AddressFormat.php:656
116 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 287 AND `id_group` = 1 LIMIT 1
 0.508 ms 0 /classes/GroupReduction.php:156
871 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.506 ms 1 /classes/stock/StockAvailable.php:753
562 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6048
ORDER BY f.position ASC
 0.506 ms 7 Yes /classes/Product.php:5993
337 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.504 ms 1 /classes/stock/StockAvailable.php:453
270 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 301 AND `id_group` = 1 LIMIT 1
 0.502 ms 0 /classes/GroupReduction.php:156
639 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4094
ORDER BY f.position ASC
 0.502 ms 7 Yes /classes/Product.php:5993
1059 
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 6533)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
 0.502 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
456 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1949
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.500 ms 1 /classes/SpecificPrice.php:259
1080 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 1) LIMIT 1
 0.500 ms 1 /src/Adapter/EntityMapper.php:71
50 
SELECT SQL_NO_CACHE *
FROM `mangayo_country_lang`
WHERE `id_country` = 10
 0.499 ms 1 /src/Adapter/EntityMapper.php:79
285 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 303
AND image_shop.`cover` = 1 LIMIT 1
 0.498 ms 1 /classes/Product.php:3570
1018 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5139
ORDER BY `position`
 0.498 ms 1 Yes /classes/Product.php:3545
1020 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5139
 0.498 ms 1 /classes/Product.php:2902
816 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8192
 0.498 ms 1 /classes/Product.php:2902
299 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.497 ms 1 /classes/SpecificPrice.php:259
330 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.497 ms 1 /classes/Product.php:5639
1054 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 403
ORDER BY `position`
 0.497 ms 1 Yes /classes/Product.php:3545
139 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 289) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.495 ms 1 /classes/stock/StockAvailable.php:453
480 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 9135)
 0.495 ms 1 /classes/Product.php:3857
277 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.494 ms 1 /classes/SpecificPrice.php:259
802 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1987
ORDER BY `position`
 0.494 ms 1 Yes /classes/Product.php:3545
814 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8192
ORDER BY `position`
 0.494 ms 1 Yes /classes/Product.php:3545
1010 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5139
 0.493 ms 3 /classes/Product.php:3423
1042 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4094
ORDER BY `position`
 0.493 ms 1 Yes /classes/Product.php:3545
1106 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php'
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme"
 0.492 ms 1 /classes/Smarty/SmartyCustom.php:184
876 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9135
 0.492 ms 1 /classes/Product.php:2902
379 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 2 LIMIT 1
 0.491 ms 0 /classes/Category.php:1375
11 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `mangayo_lang` l
JOIN mangayo_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.491 ms 1 /classes/Language.php:1216
634 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4094)
 0.491 ms 1 /classes/Product.php:3857
48 
SELECT SQL_NO_CACHE *
FROM `mangayo_state` a
WHERE (a.`id_state` = 211) LIMIT 1
 0.489 ms 1 /src/Adapter/EntityMapper.php:71
378 
SELECT SQL_NO_CACHE *
FROM `mangayo_product_lang`
WHERE `id_product` = 12211 AND `id_shop` = 1
 0.489 ms 1 /src/Adapter/EntityMapper.php:79
1124 
SELECT SQL_NO_CACHE `id_guest`
FROM `mangayo_connections`
WHERE `id_guest` = 7563427
AND `date_add` > '2024-06-28 12:37:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
 0.489 ms 1 Yes /classes/Connection.php:168
756 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php'
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
 0.488 ms 1 /classes/Smarty/SmartyCustom.php:184
413 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1987)
 0.486 ms 1 /classes/Product.php:3857
886 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8861
ORDER BY `position`
 0.486 ms 3 Yes /classes/Product.php:3545
101 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.485 ms 1 /classes/SpecificPrice.php:259
181 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 293 AND id_shop=1 LIMIT 1
 0.484 ms 1 /classes/Product.php:6848
511 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8043
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.484 ms 1 /classes/SpecificPrice.php:259
933 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7733 LIMIT 1
 0.484 ms 1 /classes/Product.php:1106
1081 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 1
 0.484 ms 1 /src/Adapter/EntityMapper.php:79
45 
SELECT SQL_NO_CACHE * FROM `mangayo_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.482 ms 18 Yes /classes/ImageType.php:109
689 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7361
ORDER BY `position`
 0.482 ms 3 Yes /classes/Product.php:3545
1117 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php'
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme"
 0.482 ms 1 /classes/Smarty/SmartyCustom.php:184
900 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8277
 0.481 ms 1 /classes/Product.php:2902
850 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1949
ORDER BY `position`
 0.479 ms 1 Yes /classes/Product.php:3545
231 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.478 ms 1 /classes/Product.php:5639
669 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6857
ORDER BY `position`
 0.478 ms 1 Yes /classes/Product.php:3545
838 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 328
ORDER BY `position`
 0.478 ms 1 Yes /classes/Product.php:3545
1000 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.478 ms 1 /modules/an_wishlist/classes/an_wish.php:76
862 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 11299
ORDER BY `position`
 0.477 ms 1 Yes /classes/Product.php:3545
916 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.477 ms 1 /modules/an_wishlist/classes/an_wish.php:76
667 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8192
ORDER BY `position`
 0.476 ms 1 Yes /classes/Product.php:3545
732 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php'
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme"
 0.476 ms 1 /classes/Smarty/SmartyCustom.php:184
1032 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4673
 0.476 ms 1 /classes/Product.php:2902
656 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6533)
 0.476 ms 1 /classes/Product.php:3857
874 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9135
ORDER BY `position`
 0.476 ms 1 Yes /classes/Product.php:3545
29 
SELECT SQL_NO_CACHE *
FROM `mangayo_group` a
LEFT JOIN `mangayo_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.474 ms 1 /src/Adapter/EntityMapper.php:71
117 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.474 ms 1 /classes/stock/StockAvailable.php:453
183 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.474 ms 1 /classes/stock/StockAvailable.php:453
989 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5479 LIMIT 1
 0.474 ms 4 /modules/an_wishlist/classes/an_wish_products.php:124
110 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.472 ms 1 /classes/Product.php:5639
115 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 287 AND id_shop=1 LIMIT 1
 0.472 ms 1 /classes/Product.php:6848
313 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 305 AND id_shop=1 LIMIT 1
 0.472 ms 1 /classes/Product.php:6848
770 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572872))
 0.472 ms 1 /classes/Smarty/SmartyCustom.php:265
671 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 328
ORDER BY `position`
 0.471 ms 1 Yes /classes/Product.php:3545
826 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6857
ORDER BY `position`
 0.471 ms 1 Yes /classes/Product.php:3545
771 
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php'
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
 0.471 ms 1 /classes/Smarty/SmartyCustom.php:184
271 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 301) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.470 ms 1 /classes/stock/StockAvailable.php:453
8 
SELECT SQL_NO_CACHE *
FROM `mangayo_lang` a
LEFT JOIN `mangayo_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
 0.470 ms 1 /src/Adapter/EntityMapper.php:71
249 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.470 ms 1 /classes/stock/StockAvailable.php:453
222 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.468 ms 1 /classes/SpecificPrice.php:259
81 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 284 AND `id_group` = 1 LIMIT 1
 0.467 ms 0 /classes/GroupReduction.php:156
1030 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4673
ORDER BY `position`
 0.467 ms 1 Yes /classes/Product.php:3545
275 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.466 ms 1 /classes/Product.php:5639
864 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 11299
 0.466 ms 1 /classes/Product.php:2902
1024 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.466 ms 1 /modules/an_wishlist/classes/an_wish.php:76
112 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.465 ms 1 /classes/SpecificPrice.php:259
952 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.465 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1085 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 16) LIMIT 1
 0.465 ms 1 /src/Adapter/EntityMapper.php:71
132 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.464 ms 1 /classes/Product.php:5639
187 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.464 ms 1 /classes/Product.php:5639
441 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 328
AND image_shop.`cover` = 1 LIMIT 1
 0.464 ms 1 /classes/Product.php:3570
683 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8043
ORDER BY `position`
 0.463 ms 3 Yes /classes/Product.php:3545
435 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6857)
 0.462 ms 1 /classes/Product.php:3857
242 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.462 ms 1 /classes/Product.php:5639
918 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.462 ms 1 /classes/stock/StockAvailable.php:778
126 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 288 AND id_shop=1 LIMIT 1
 0.461 ms 1 /classes/Product.php:6848
143 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.461 ms 1 /classes/Product.php:5639
145 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 290
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.461 ms 1 /classes/SpecificPrice.php:259
792 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 10978
 0.461 ms 1 /classes/Product.php:2902
161 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 291) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.461 ms 1 /classes/stock/StockAvailable.php:453
936 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7733
 0.460 ms 1 /classes/Product.php:2902
247 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 299 AND id_shop=1 LIMIT 1
 0.460 ms 1 /classes/Product.php:6848
104 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 286 AND id_shop=1 LIMIT 1
 0.459 ms 1 /classes/Product.php:6848
167 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 292
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.458 ms 1 /classes/SpecificPrice.php:259
1037 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4094 LIMIT 1
 0.458 ms 63 /modules/an_wishlist/classes/an_wish_products.php:124
1130 
UPDATE `mangayo_page_viewed`
SET `counter` = `counter` + 1
WHERE `id_date_range` = 9307
AND `id_page` = 48
AND `id_shop` = 1
 0.458 ms 1 /classes/Page.php:131
138 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 289 AND `id_group` = 1 LIMIT 1
 0.457 ms 0 /classes/GroupReduction.php:156
227 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.457 ms 1 /classes/stock/StockAvailable.php:453
419 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8192
AND image_shop.`cover` = 1 LIMIT 1
 0.457 ms 1 /classes/Product.php:3570
83 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.456 ms 1 /classes/stock/StockAvailable.php:453
121 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.456 ms 1 /classes/Product.php:5639
662 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10978
ORDER BY `position`
 0.456 ms 1 Yes /classes/Product.php:3545
870 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.456 ms 1 /classes/stock/StockAvailable.php:778
74 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.455 ms 1 /classes/SpecificPrice.php:259
255 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 300
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.455 ms 1 /classes/SpecificPrice.php:259
1104 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 23 AND `id_shop` = 1
 0.455 ms 1 /src/Adapter/EntityMapper.php:79
99 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.454 ms 1 /classes/Product.php:5639
749 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
 0.454 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
26 
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.453 ms 1 /src/Adapter/EntityMapper.php:71
679 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8861
ORDER BY `position`
 0.453 ms 3 Yes /classes/Product.php:3545
348 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_searchbar" LIMIT 1
 0.452 ms 1 /classes/module/Module.php:2636
1097 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 10) LIMIT 1
 0.452 ms 1 /src/Adapter/EntityMapper.php:71
1079 
SELECT SQL_NO_CACHE lb.`id_link_block`
FROM mangayo_link_block lb
INNER JOIN mangayo_link_block_shop lbs ON lbs.`id_link_block` = lb.`id_link_block`
WHERE lb. `id_hook` = 35 AND lbs.`id_shop` = 1
ORDER by lbs.`position`
 0.452 ms 4 Yes /modules/ps_linklist/src/LegacyLinkBlockRepository.php:87
127 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 288 AND `id_group` = 1 LIMIT 1
 0.451 ms 0 /classes/GroupReduction.php:156
705 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4094
ORDER BY `position`
 0.451 ms 1 Yes /classes/Product.php:3545
148 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 290 AND id_shop=1 LIMIT 1
 0.450 ms 1 /classes/Product.php:6848
205 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.450 ms 1 /classes/stock/StockAvailable.php:453
156 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 291
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.450 ms 1 /classes/SpecificPrice.php:259
1026 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.450 ms 1 /classes/stock/StockAvailable.php:778
63 
SELECT SQL_NO_CACHE * FROM `mangayo_image_type`
 0.449 ms 18 /classes/ImageType.php:161
424 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8192)
 0.449 ms 1 /classes/Product.php:3857
1086 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 16 AND `id_shop` = 1
 0.449 ms 1 /src/Adapter/EntityMapper.php:79
209 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.448 ms 1 /classes/Product.php:5639
632 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4094
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.448 ms 1 /classes/SpecificPrice.php:259
68 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.447 ms 1 /classes/Product.php:5639
90 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.447 ms 1 /classes/SpecificPrice.php:259
172 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.447 ms 1 /classes/stock/StockAvailable.php:453
150 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 290) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.446 ms 1 /classes/stock/StockAvailable.php:453
105 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 286 AND `id_group` = 1 LIMIT 1
 0.446 ms 0 /classes/GroupReduction.php:156
178 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.446 ms 1 /classes/SpecificPrice.php:259
95 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.445 ms 1 /classes/stock/StockAvailable.php:453
204 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 295 AND `id_group` = 1 LIMIT 1
 0.445 ms 0 /classes/GroupReduction.php:156
216 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.445 ms 1 /classes/stock/StockAvailable.php:453
852 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1949
 0.445 ms 1 /classes/Product.php:2902
1050 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 403) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.445 ms 1 /classes/stock/StockAvailable.php:778
7 
SELECT SQL_NO_CACHE *
FROM `mangayo_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.444 ms 1 /src/Adapter/EntityMapper.php:71
610 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5139
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.444 ms 1 /classes/SpecificPrice.php:259
22 
SELECT SQL_NO_CACHE value FROM `mangayo_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.443 ms 1 /classes/shop/Shop.php:1183
128 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 288) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.443 ms 1 /classes/stock/StockAvailable.php:453
160 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 291 AND `id_group` = 1 LIMIT 1
 0.443 ms 0 /classes/GroupReduction.php:156
590 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5479)
 0.443 ms 1 /classes/Product.php:3857
758 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572872))
 0.443 ms 1 /classes/Smarty/SmartyCustom.php:265
171 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 292 AND `id_group` = 1 LIMIT 1
 0.442 ms 0 /classes/GroupReduction.php:156
198 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.441 ms 1 /classes/Product.php:5639
447 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 328)
 0.440 ms 1 /classes/Product.php:3857
189 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 294
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.440 ms 1 /classes/SpecificPrice.php:259
214 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 296 AND id_shop=1 LIMIT 1
 0.439 ms 1 /classes/Product.php:6848
764 
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
 0.439 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
1092 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 19 AND `id_shop` = 1
 0.438 ms 1 /src/Adapter/EntityMapper.php:79
82 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_group`
WHERE `id_group` = 1 LIMIT 1
 0.438 ms 1 /classes/Group.php:154
430 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6857
AND image_shop.`cover` = 1 LIMIT 1
 0.438 ms 1 /classes/Product.php:3570
612 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5139)
 0.438 ms 1 /classes/Product.php:3857
28 
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
 0.437 ms 1 /classes/ObjectModel.php:1729
321 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.437 ms 1 /classes/SpecificPrice.php:259
375 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "payplug" LIMIT 1
 0.437 ms 1 /classes/module/Module.php:2636
1102 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 15 AND `id_shop` = 1
 0.437 ms 1 /src/Adapter/EntityMapper.php:79
880 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.437 ms 1 /modules/an_wishlist/classes/an_wish.php:76
36 
SELECT SQL_NO_CACHE * FROM `mangayo_hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.436 ms 1 /classes/module/Module.php:2018
182 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 293 AND `id_group` = 1 LIMIT 1
 0.436 ms 0 /classes/GroupReduction.php:156
200 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.435 ms 1 /classes/SpecificPrice.php:259
404 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 10978 AND `id_group` = 1 LIMIT 1
 0.435 ms 0 /classes/GroupReduction.php:156
286 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.435 ms 1 /classes/Product.php:5639
137 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 289 AND id_shop=1 LIMIT 1
 0.434 ms 1 /classes/Product.php:6848
687 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7733
ORDER BY `position`
 0.434 ms 1 Yes /classes/Product.php:3545
60 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='compile' LIMIT 1
 0.433 ms 1 /classes/Smarty/SmartyCustom.php:96
402 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10978)
 0.433 ms 1 /classes/Product.php:3857
699 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5143
ORDER BY `position`
 0.433 ms 1 Yes /classes/Product.php:3545
291 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 303 AND id_shop=1 LIMIT 1
 0.432 ms 1 /classes/Product.php:6848
566 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5773
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.432 ms 1 /classes/SpecificPrice.php:259
832 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.432 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1123 
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_icons` sw
WHERE sw.`active`=1
 0.432 ms 40 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php:84
31 
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.431 ms 1 /classes/ObjectModel.php:1729
332 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.431 ms 1 /classes/SpecificPrice.php:259
522 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7937
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.431 ms 1 /classes/SpecificPrice.php:259
730 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme" LIMIT 1
 0.431 ms 1 /classes/Smarty/SmartyCustom.php:216
809 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8192 LIMIT 1
 0.431 ms 3 /modules/an_wishlist/classes/an_wish_products.php:124
49 
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
 0.431 ms 1 /src/Adapter/EntityMapper.php:71
326 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.431 ms 1 /classes/stock/StockAvailable.php:453
697 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5479
ORDER BY `position`
 0.430 ms 1 Yes /classes/Product.php:3545
280 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 302 AND id_shop=1 LIMIT 1
 0.430 ms 1 /classes/Product.php:6848
77 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 284 AND id_shop=1 LIMIT 1
 0.429 ms 1 /classes/Product.php:6848
533 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7733
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.429 ms 1 /classes/SpecificPrice.php:259
225 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 297 AND id_shop=1 LIMIT 1
 0.428 ms 1 /classes/Product.php:6848
253 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.428 ms 1 /classes/Product.php:5639
623 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4673)
 0.428 ms 1 /classes/Product.php:3857
905 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8043 LIMIT 1
 0.428 ms 10 /modules/an_wishlist/classes/an_wish_products.php:124
149 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 290 AND `id_group` = 1 LIMIT 1
 0.427 ms 0 /classes/GroupReduction.php:156
469 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 11299)
 0.427 ms 1 /classes/Product.php:3857
685 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 7937
ORDER BY `position`
 0.427 ms 1 Yes /classes/Product.php:3545
707 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 403
ORDER BY `position`
 0.427 ms 1 Yes /classes/Product.php:3545
61 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedpack" LIMIT 1
 0.426 ms 0 /classes/module/Module.php:2636
508 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8043
AND image_shop.`cover` = 1 LIMIT 1
 0.426 ms 3 /classes/Product.php:3570
552 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6048
AND image_shop.`cover` = 1 LIMIT 1
 0.426 ms 1 /classes/Product.php:3570
976 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.426 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1093 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 8) LIMIT 1
 0.426 ms 1 /src/Adapter/EntityMapper.php:71
1122 
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_widgets` sw
LEFT JOIN `mangayo_an_trust_badges_widgets_lang` sl 
ON (sw.`id_widget` = sl.`id_widget`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1 
AND sw.`hook`="displayCopyrightContainer"
 0.426 ms 2 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php:86
106 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.426 ms 1 /classes/stock/StockAvailable.php:453
1108 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme" LIMIT 1
 0.425 ms 0 /classes/Smarty/SmartyCustom.php:216
266 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 301
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.425 ms 1 /classes/SpecificPrice.php:259
759 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572872))
 0.425 ms 1 /classes/Smarty/SmartyCustom.php:265
351 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.424 ms 0 /classes/module/Module.php:2109
502 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8277)
 0.424 ms 1 /classes/Product.php:3857
408 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1987
AND image_shop.`cover` = 1 LIMIT 1
 0.424 ms 1 /classes/Product.php:3570
585 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5479
AND image_shop.`cover` = 1 LIMIT 1
 0.424 ms 1 /classes/Product.php:3570
1036 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.424 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1058 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6533
 0.424 ms 3 /classes/Product.php:3423
211 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.423 ms 1 /classes/SpecificPrice.php:259
315 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.423 ms 1 /classes/stock/StockAvailable.php:453
475 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 9135
AND image_shop.`cover` = 1 LIMIT 1
 0.423 ms 1 /classes/Product.php:3570
675 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 11299
ORDER BY `position`
 0.423 ms 1 Yes /classes/Product.php:3545
1099 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 11) LIMIT 1
 0.423 ms 1 /src/Adapter/EntityMapper.php:71
248 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 299 AND `id_group` = 1 LIMIT 1
 0.422 ms 0 /classes/GroupReduction.php:156
282 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.422 ms 1 /classes/stock/StockAvailable.php:453
308 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.422 ms 1 /classes/Product.php:5639
459 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1949 AND id_shop=1 LIMIT 1
 0.422 ms 1 /classes/Product.php:6848
691 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6048
ORDER BY `position`
 0.422 ms 1 Yes /classes/Product.php:3545
731 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('4a4b03e34f9266c4e082efcc7a2e039e',"","charme", FROM_UNIXTIME(1719572872))
 0.422 ms 1 /classes/Smarty/SmartyCustom.php:265
1053 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 403 LIMIT 1
 0.422 ms 1 /classes/Product.php:1106
170 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 292 AND id_shop=1 LIMIT 1
 0.421 ms 1 /classes/Product.php:6848
453 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1949
AND image_shop.`cover` = 1 LIMIT 1
 0.421 ms 1 /classes/Product.php:3570
950 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6048
 0.421 ms 3 /classes/Product.php:3423
966 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.421 ms 1 /classes/stock/StockAvailable.php:778
233 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.421 ms 1 /classes/SpecificPrice.php:259
264 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.420 ms 1 /classes/Product.php:5639
892 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.420 ms 1 /modules/an_wishlist/classes/an_wish.php:76
244 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.420 ms 1 /classes/SpecificPrice.php:259
645 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 403)
 0.419 ms 1 /classes/Product.php:3857
549 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.419 ms 1 /classes/stock/StockAvailable.php:453
743 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572872))
 0.419 ms 1 /classes/Smarty/SmartyCustom.php:265
888 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8861
 0.419 ms 1 /classes/Product.php:2902
624 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4673 AND id_shop=1 LIMIT 1
 0.418 ms 1 /classes/Product.php:6848
260 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 300) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.418 ms 1 /classes/stock/StockAvailable.php:453
806 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8192
 0.418 ms 3 /classes/Product.php:3423
894 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.418 ms 1 /classes/stock/StockAvailable.php:778
1060 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.418 ms 1 /modules/an_wishlist/classes/an_wish.php:76
72 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `from` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
 0.417 ms 1 /classes/SpecificPrice.php:377
73 
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `to` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
 0.417 ms 1 /classes/SpecificPrice.php:381
665 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1987
ORDER BY `position`
 0.417 ms 1 Yes /classes/Product.php:3545
921 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7937 LIMIT 1
 0.417 ms 1 /classes/Product.php:1106
928 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.417 ms 1 /modules/an_wishlist/classes/an_wish.php:76
969 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5773 LIMIT 1
 0.417 ms 1 /classes/Product.php:1106
981 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5603 LIMIT 1
 0.417 ms 1 /classes/Product.php:1106
1084 
SELECT SQL_NO_CACHE *
FROM `mangayo_hook` a
WHERE (a.`id_hook` = 35) LIMIT 1
 0.417 ms 1 /src/Adapter/EntityMapper.php:71
325 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 306 AND `id_group` = 1 LIMIT 1
 0.416 ms 0 /classes/GroupReduction.php:156
844 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.416 ms 1 /modules/an_wishlist/classes/an_wish.php:76
557 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6048)
 0.416 ms 1 /classes/Product.php:3857
776 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_categorytree" LIMIT 1
 0.416 ms 1 /classes/module/Module.php:2636
849 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1949 LIMIT 1
 0.416 ms 1 /classes/Product.php:1106
673 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1949
ORDER BY `position`
 0.415 ms 1 Yes /classes/Product.php:3545
813 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8192 LIMIT 1
 0.415 ms 1 /classes/Product.php:1106
319 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.415 ms 1 /classes/Product.php:5639
575 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.415 ms 1 /classes/Product.php:5639
801 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1987 LIMIT 1
 0.415 ms 1 /classes/Product.php:1106
226 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 297 AND `id_group` = 1 LIMIT 1
 0.414 ms 0 /classes/GroupReduction.php:156
176 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.414 ms 1 /classes/Product.php:5639
450 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.414 ms 1 /classes/stock/StockAvailable.php:453
476 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.414 ms 1 /classes/Product.php:5639
27 
SELECT SQL_NO_CACHE *
FROM `mangayo_currency_lang`
WHERE `id_currency` = 1
 0.413 ms 1 /src/Adapter/EntityMapper.php:79
269 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 301 AND id_shop=1 LIMIT 1
 0.413 ms 1 /classes/Product.php:6848
774 
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
 0.413 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
10 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM mangayo_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.413 ms 1 /classes/shop/ShopUrl.php:182
345 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
 0.413 ms 0 /classes/module/Module.php:2636
651 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6533
AND image_shop.`cover` = 1 LIMIT 1
 0.413 ms 1 /classes/Product.php:3570
772 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "sociallogin" LIMIT 1
 0.413 ms 1 /classes/module/Module.php:2636
1126 
SELECT SQL_NO_CACHE `id_page`
FROM `mangayo_page`
WHERE `id_page_type` = 7 AND `id_object` = 11 LIMIT 1
 0.413 ms 1 /classes/Page.php:83
349 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 25 AND `id_shop` = 1 LIMIT 1
 0.412 ms 1 /classes/module/Module.php:2109
396 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10978
AND image_shop.`cover` = 1 LIMIT 1
 0.412 ms 1 /classes/Product.php:3570
787 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 10978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.412 ms 1 /classes/stock/StockAvailable.php:753
837 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 328 LIMIT 1
 0.412 ms 1 /classes/Product.php:1106
897 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8277 LIMIT 1
 0.412 ms 1 /classes/Product.php:1106
1068 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6533
 0.412 ms 1 /classes/Product.php:2902
93 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 285 AND id_shop=1 LIMIT 1
 0.411 ms 1 /classes/Product.php:6848
297 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.411 ms 1 /classes/Product.php:5639
438 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6857) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.411 ms 1 /classes/stock/StockAvailable.php:453
574 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5603
AND image_shop.`cover` = 1 LIMIT 1
 0.411 ms 1 /classes/Product.php:3570
893 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8277 LIMIT 1
 0.411 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
873 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 9135 LIMIT 1
 0.411 ms 1 /classes/Product.php:1106
30 
SELECT SQL_NO_CACHE *
FROM `mangayo_group_lang`
WHERE `id_group` = 1
 0.410 ms 1 /src/Adapter/EntityMapper.php:79
302 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 304 AND id_shop=1 LIMIT 1
 0.410 ms 1 /classes/Product.php:6848
711 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_theme" LIMIT 1
 0.410 ms 1 /classes/module/Module.php:2636
1017 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5139 LIMIT 1
 0.410 ms 1 /classes/Product.php:1106
1114 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572873))
 0.410 ms 1 /classes/Smarty/SmartyCustom.php:265
51 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM mangayo_required_field
 0.410 ms 1 /classes/ObjectModel.php:1592
154 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.409 ms 1 /classes/Product.php:5639
361 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.409 ms 0 /classes/module/Module.php:2109
881 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8861 LIMIT 1
 0.409 ms 8 /modules/an_wishlist/classes/an_wish_products.php:124
967 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.409 ms 1 /classes/stock/StockAvailable.php:753
203 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 295 AND id_shop=1 LIMIT 1
 0.408 ms 1 /classes/Product.php:6848
458 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1949)
 0.408 ms 1 /classes/Product.php:3857
681 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8277
ORDER BY `position`
 0.408 ms 1 Yes /classes/Product.php:3545
904 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.408 ms 1 /modules/an_wishlist/classes/an_wish.php:76
986 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5479
 0.408 ms 3 /classes/Product.php:3423
1083 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 6
 0.408 ms 1 /src/Adapter/EntityMapper.php:79
55 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 142 AND `id_shop` = 1 LIMIT 1
 0.407 ms 0 /classes/module/Module.php:2109
629 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4094
AND image_shop.`cover` = 1 LIMIT 1
 0.407 ms 1 /classes/Product.php:3570
733 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customersignin" LIMIT 1
 0.407 ms 1 /classes/module/Module.php:2636
834 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.407 ms 1 /classes/stock/StockAvailable.php:778
902 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8043
 0.407 ms 3 /classes/Product.php:3423
917 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7937 LIMIT 1
 0.407 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
193 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 294 AND `id_group` = 1 LIMIT 1
 0.406 ms 0 /classes/GroupReduction.php:156
310 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.406 ms 1 /classes/SpecificPrice.php:259
658 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6533 AND `id_group` = 1 LIMIT 1
 0.406 ms 0 /classes/GroupReduction.php:156
701 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5139
ORDER BY `position`
 0.406 ms 1 Yes /classes/Product.php:3545
909 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8043 LIMIT 1
 0.406 ms 1 /classes/Product.php:1106
919 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.406 ms 1 /classes/stock/StockAvailable.php:753
940 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.406 ms 1 /modules/an_wishlist/classes/an_wish.php:76
304 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.406 ms 1 /classes/stock/StockAvailable.php:453
258 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 300 AND id_shop=1 LIMIT 1
 0.405 ms 1 /classes/Product.php:6848
785 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 10978 LIMIT 1
 0.405 ms 38 /modules/an_wishlist/classes/an_wish_products.php:124
220 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.404 ms 1 /classes/Product.php:5639
303 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 304 AND `id_group` = 1 LIMIT 1
 0.404 ms 0 /classes/GroupReduction.php:156
996 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5479
 0.404 ms 1 /classes/Product.php:2902
709 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6533
ORDER BY `position`
 0.404 ms 1 Yes /classes/Product.php:3545
825 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6857 LIMIT 1
 0.404 ms 1 /classes/Product.php:1106
324 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 306 AND id_shop=1 LIMIT 1
 0.403 ms 1 /classes/Product.php:6848
513 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8043)
 0.403 ms 1 /classes/Product.php:3857
427 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.403 ms 1 /classes/stock/StockAvailable.php:453
486 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8861
AND image_shop.`cover` = 1 LIMIT 1
 0.403 ms 3 /classes/Product.php:3570
993 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5479 LIMIT 1
 0.403 ms 1 /classes/Product.php:1106
695 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5603
ORDER BY `position`
 0.402 ms 1 Yes /classes/Product.php:3545
3 
SELECT SQL_NO_CACHE *
FROM `mangayo_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.402 ms 1 /src/Adapter/EntityMapper.php:71
165 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.402 ms 1 /classes/Product.php:5639
88 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.401 ms 1 /classes/Product.php:5639
192 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 294 AND id_shop=1 LIMIT 1
 0.401 ms 1 /classes/Product.php:6848
717 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 157 AND `id_shop` = 1 LIMIT 1
 0.401 ms 1 /classes/module/Module.php:2109
978 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.401 ms 1 /classes/stock/StockAvailable.php:778
1109 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('9b994322a10138ad46146161c46d70ed',"","charme", FROM_UNIXTIME(1719572873))
 0.401 ms 1 /classes/Smarty/SmartyCustom.php:265
784 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.400 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1048 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.400 ms 1 /modules/an_wishlist/classes/an_wish.php:76
607 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5139
AND image_shop.`cover` = 1 LIMIT 1
 0.400 ms 1 /classes/Product.php:3570
23 
SELECT SQL_NO_CACHE c.id_currency
FROM `mangayo_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.399 ms 1 /classes/Currency.php:893
535 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 7733)
 0.399 ms 1 /classes/Product.php:3857
824 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6857) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.399 ms 1 /classes/stock/StockAvailable.php:806
236 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 298 AND id_shop=1 LIMIT 1
 0.398 ms 1 /classes/Product.php:6848
159 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 291 AND id_shop=1 LIMIT 1
 0.398 ms 1 /classes/Product.php:6848
677 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 9135
ORDER BY `position`
 0.398 ms 1 Yes /classes/Product.php:3545
1065 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 6533 LIMIT 1
 0.398 ms 1 /classes/Product.php:1106
494 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.397 ms 1 /classes/stock/StockAvailable.php:453
920 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.397 ms 1 /classes/stock/StockAvailable.php:806
1046 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 403
 0.397 ms 3 /classes/Product.php:3423
53 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_homecategories" LIMIT 1
 0.396 ms 0 /classes/module/Module.php:2636
259 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 300 AND `id_group` = 1 LIMIT 1
 0.396 ms 0 /classes/GroupReduction.php:156
519 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7937
AND image_shop.`cover` = 1 LIMIT 1
 0.396 ms 1 /classes/Product.php:3570
820 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.396 ms 1 /modules/an_wishlist/classes/an_wish.php:76
924 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7937
 0.396 ms 1 /classes/Product.php:2902
1025 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4673 LIMIT 1
 0.396 ms 31 /modules/an_wishlist/classes/an_wish_products.php:124
1029 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4673 LIMIT 1
 0.396 ms 1 /classes/Product.php:1106
1118 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_copyright" LIMIT 1
 0.396 ms 1 /classes/module/Module.php:2636
9 
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
 0.395 ms 1 /classes/ObjectModel.php:1729
693 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5773
ORDER BY `position`
 0.395 ms 1 Yes /classes/Product.php:3545
926 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7733
 0.395 ms 3 /classes/Product.php:3423
1034 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4094
 0.395 ms 2 /classes/Product.php:3423
1087 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) LIMIT 1
 0.394 ms 1 /src/Adapter/EntityMapper.php:71
215 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 296 AND `id_group` = 1 LIMIT 1
 0.393 ms 0 /classes/GroupReduction.php:156
755 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572872))
 0.393 ms 1 /classes/Smarty/SmartyCustom.php:265
1003 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.393 ms 1 /classes/stock/StockAvailable.php:753
563 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5773
AND image_shop.`cover` = 1 LIMIT 1
 0.392 ms 1 /classes/Product.php:3570
596 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5143
AND image_shop.`cover` = 1 LIMIT 1
 0.392 ms 1 /classes/Product.php:3570
599 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5143
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.392 ms 1 /classes/SpecificPrice.php:259
945 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 7361 LIMIT 1
 0.392 ms 1 /classes/Product.php:1106
1119 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 148 AND `id_shop` = 1 LIMIT 1
 0.392 ms 1 /classes/module/Module.php:2109
601 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5143)
 0.391 ms 1 /classes/Product.php:3857
640 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 403
AND image_shop.`cover` = 1 LIMIT 1
 0.391 ms 1 /classes/Product.php:3570
789 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 10978 LIMIT 1
 0.391 ms 1 /classes/Product.php:1106
1095 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 9) LIMIT 1
 0.391 ms 1 /src/Adapter/EntityMapper.php:71
357 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.390 ms 0 /classes/module/Module.php:2109
358 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labblocksearch" LIMIT 1
 0.390 ms 0 /classes/module/Module.php:2636
370 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tdsearchblock" LIMIT 1
 0.390 ms 0 /classes/module/Module.php:2636
461 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1949) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.390 ms 1 /classes/stock/StockAvailable.php:453
530 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 7733
AND image_shop.`cover` = 1 LIMIT 1
 0.390 ms 1 /classes/Product.php:3570
1069 
SELECT SQL_NO_CACHE *
FROM `mangayo_image_type` a
WHERE (a.`id_image_type` = 14) LIMIT 1
 0.390 ms 1 /src/Adapter/EntityMapper.php:71
25 
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
 0.389 ms 1 /classes/Language.php:883
380 
SELECT SQL_NO_CACHE e.`id_product` as id
FROM `mangayo_product` e
WHERE (e.`id_product` = 12211) LIMIT 1
 0.389 ms 1 /classes/ObjectModel.php:2029
619 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.388 ms 1 /classes/Product.php:5639
788 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 10978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.388 ms 1 /classes/stock/StockAvailable.php:806
931 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.388 ms 1 /classes/stock/StockAvailable.php:753
43 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.388 ms 0 /classes/module/Module.php:2636
47 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
 0.388 ms 1 /classes/Country.php:402
376 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 131 AND `id_shop` = 1 LIMIT 1
 0.388 ms 1 /classes/module/Module.php:2109
54 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "productcomments" LIMIT 1
 0.387 ms 1 /classes/module/Module.php:2636
397 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.387 ms 1 /classes/Product.php:5639
885 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8861 LIMIT 1
 0.387 ms 1 /classes/Product.php:1106
965 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5773 LIMIT 1
 0.387 ms 12 /modules/an_wishlist/classes/an_wish_products.php:124
1101 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 15) LIMIT 1
 0.387 ms 1 /src/Adapter/EntityMapper.php:71
21 
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
 0.386 ms 1 /classes/Language.php:883
32 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM mangayo_category_group ctg
WHERE ctg.`id_category` = 11 AND ctg.`id_group` = 1 LIMIT 1
 0.386 ms 1 /classes/Category.php:1751
355 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.386 ms 0 /classes/module/Module.php:2109
359 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.386 ms 0 /classes/module/Module.php:2109
797 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1987 LIMIT 1
 0.386 ms 51 /modules/an_wishlist/classes/an_wish_products.php:124
833 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 328 LIMIT 1
 0.386 ms 73 /modules/an_wishlist/classes/an_wish_products.php:124
1073 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
 0.386 ms 1 /classes/Country.php:402
335 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 307 AND id_shop=1 LIMIT 1
 0.385 ms 1 /classes/Product.php:6848
431 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.385 ms 1 /classes/Product.php:5639
537 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7733 AND `id_group` = 1 LIMIT 1
 0.385 ms 0 /classes/GroupReduction.php:156
906 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.385 ms 1 /classes/stock/StockAvailable.php:778
1016 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.385 ms 1 /classes/stock/StockAvailable.php:806
757 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.385 ms 0 /classes/Smarty/SmartyCustom.php:216
988 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.385 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1038 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.385 ms 1 /classes/stock/StockAvailable.php:778
1071 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_contactinfo" LIMIT 1
 0.385 ms 1 /classes/module/Module.php:2636
1103 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 23) LIMIT 1
 0.385 ms 1 /src/Adapter/EntityMapper.php:71
366 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "jmsajaxsearch" LIMIT 1
 0.384 ms 0 /classes/module/Module.php:2636
367 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.384 ms 0 /classes/module/Module.php:2109
727 
SELECT SQL_NO_CACHE *
FROM `mangayo_dark_mode` a
WHERE (a.`id` = 1) LIMIT 1
 0.384 ms 1 /src/Adapter/EntityMapper.php:71
942 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.384 ms 1 /classes/stock/StockAvailable.php:778
962 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5773
 0.384 ms 3 /classes/Product.php:3423
505 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.384 ms 1 /classes/stock/StockAvailable.php:453
1001 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5143 LIMIT 1
 0.384 ms 6 /modules/an_wishlist/classes/an_wish_products.php:124
1098 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 10 AND `id_shop` = 1
 0.384 ms 1 /src/Adapter/EntityMapper.php:79
744 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572872))
 0.383 ms 1 /classes/Smarty/SmartyCustom.php:265
796 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.383 ms 1 /modules/an_wishlist/classes/an_wish.php:76
414 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1987 AND id_shop=1 LIMIT 1
 0.382 ms 1 /classes/Product.php:6848
821 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6857 LIMIT 1
 0.382 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
990 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.382 ms 1 /classes/stock/StockAvailable.php:778
1012 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.382 ms 1 /modules/an_wishlist/classes/an_wish.php:76
62 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "btfacebookchats" LIMIT 1
 0.381 ms 0 /classes/module/Module.php:2636
618 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4673
AND image_shop.`cover` = 1 LIMIT 1
 0.381 ms 1 /classes/Product.php:3570
643 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 403
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.381 ms 1 /classes/SpecificPrice.php:259
666 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1987
 0.381 ms 1 /classes/Product.php:2902
706 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4094
 0.381 ms 1 /classes/Product.php:2902
858 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 11299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.381 ms 1 /classes/stock/StockAvailable.php:778
938 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7361
 0.381 ms 3 /classes/Product.php:3423
964 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.381 ms 1 /modules/an_wishlist/classes/an_wish.php:76
365 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.380 ms 0 /classes/module/Module.php:2109
420 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.380 ms 1 /classes/Product.php:5639
799 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1987) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.380 ms 1 /classes/stock/StockAvailable.php:753
884 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.380 ms 1 /classes/stock/StockAvailable.php:806
1005 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 5143 LIMIT 1
 0.380 ms 1 /classes/Product.php:1106
1041 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4094 LIMIT 1
 0.380 ms 1 /classes/Product.php:1106
742 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.380 ms 0 /classes/Smarty/SmartyCustom.php:216
497 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8277
AND image_shop.`cover` = 1 LIMIT 1
 0.379 ms 1 /classes/Product.php:3570
713 
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
 0.379 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
808 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.379 ms 1 /modules/an_wishlist/classes/an_wish.php:76
830 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 328
 0.379 ms 3 /classes/Product.php:3423
314 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 305 AND `id_group` = 1 LIMIT 1
 0.379 ms 0 /classes/GroupReduction.php:156
868 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.379 ms 1 /modules/an_wishlist/classes/an_wish.php:76
729 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='template' LIMIT 1
 0.378 ms 1 /classes/Smarty/SmartyCustom.php:143
403 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 10978 AND id_shop=1 LIMIT 1
 0.377 ms 1 /classes/Product.php:6848
571 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.377 ms 1 /classes/stock/StockAvailable.php:453
861 
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 11299 LIMIT 1
 0.377 ms 1 /classes/Product.php:1106
980 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.377 ms 1 /classes/stock/StockAvailable.php:806
44 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.376 ms 0 /classes/module/Module.php:2109
343 
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 2) LIMIT 1
 0.376 ms 1 /classes/Category.php:1971
442 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.376 ms 1 /classes/Product.php:5639
998 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5143
 0.376 ms 3 /classes/Product.php:3423
1091 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 19) LIMIT 1
 0.376 ms 1 /src/Adapter/EntityMapper.php:71
57 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_reviews" LIMIT 1
 0.375 ms 0 /classes/module/Module.php:2636
737 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.375 ms 1 /modules/an_wishlist/classes/an_wish.php:76
836 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.375 ms 1 /classes/stock/StockAvailable.php:806
866 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 9135
 0.375 ms 3 /classes/Product.php:3423
1027 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.375 ms 1 /classes/stock/StockAvailable.php:753
1111 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customeraccountlinks" LIMIT 1
 0.375 ms 1 /classes/module/Module.php:2636
281 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 302 AND `id_group` = 1 LIMIT 1
 0.375 ms 0 /classes/GroupReduction.php:156
425 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8192 AND id_shop=1 LIMIT 1
 0.374 ms 1 /classes/Product.php:6848
840 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 328
 0.374 ms 1 /classes/Product.php:2902
914 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 7937
 0.374 ms 3 /classes/Product.php:3423
1056 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 403
 0.374 ms 1 /classes/Product.php:2902
1131 
SELECT SQL_NO_CACHE data
FROM `mangayo_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
 0.374 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
489 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8861
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.373 ms 1 /classes/SpecificPrice.php:259
577 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5603
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.373 ms 1 /classes/SpecificPrice.php:259
779 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_productattributes" LIMIT 1
 0.373 ms 1 /classes/module/Module.php:2636
794 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1987
 0.373 ms 5 /classes/Product.php:3423
930 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.373 ms 1 /classes/stock/StockAvailable.php:778
835 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.373 ms 1 /classes/stock/StockAvailable.php:753
854 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 11299
 0.373 ms 2 /classes/Product.php:3423
882 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.372 ms 1 /classes/stock/StockAvailable.php:778
1051 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 403) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.372 ms 1 /classes/stock/StockAvailable.php:753
740 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_logo" LIMIT 1
 0.372 ms 1 /classes/module/Module.php:2636
1125 
SELECT SQL_NO_CACHE id_page_type
FROM mangayo_page_type
WHERE name = 'category' LIMIT 1
 0.372 ms 1 /classes/Page.php:104
416 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1987) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.371 ms 1 /classes/stock/StockAvailable.php:453
362 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tvcmssearch" LIMIT 1
 0.371 ms 0 /classes/module/Module.php:2636
588 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 5479
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.371 ms 1 /classes/SpecificPrice.php:259
908 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.371 ms 1 /classes/stock/StockAvailable.php:806
818 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 6857
 0.370 ms 3 /classes/Product.php:3423
845 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1949 LIMIT 1
 0.370 ms 35 /modules/an_wishlist/classes/an_wish_products.php:124
883 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8861) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.370 ms 1 /classes/stock/StockAvailable.php:753
954 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.370 ms 1 /classes/stock/StockAvailable.php:778
822 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6857) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.369 ms 1 /classes/stock/StockAvailable.php:778
846 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1949) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.369 ms 1 /classes/stock/StockAvailable.php:778
1112 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 14 AND `id_shop` = 1 LIMIT 1
 0.369 ms 1 /classes/module/Module.php:2109
237 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 298 AND `id_group` = 1 LIMIT 1
 0.368 ms 0 /classes/GroupReduction.php:156
368 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "bonsearch" LIMIT 1
 0.368 ms 0 /classes/module/Module.php:2636
672 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 328
 0.367 ms 1 /classes/Product.php:2902
682 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8277
 0.366 ms 1 /classes/Product.php:2902
890 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8277
 0.366 ms 3 /classes/Product.php:3423
907 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.366 ms 1 /classes/stock/StockAvailable.php:753
1062 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.366 ms 1 /classes/stock/StockAvailable.php:778
373 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.365 ms 0 /classes/module/Module.php:2109
773 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1
 0.365 ms 1 /classes/module/Module.php:2109
800 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1987) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.365 ms 1 /classes/stock/StockAvailable.php:806
804 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1987
 0.365 ms 1 /classes/Product.php:2902
810 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.365 ms 1 /classes/stock/StockAvailable.php:778
857 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 11299 LIMIT 1
 0.365 ms 10 /modules/an_wishlist/classes/an_wish_products.php:124
1072 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 12 AND `id_shop` = 1 LIMIT 1
 0.365 ms 1 /classes/module/Module.php:2109
828 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6857
 0.364 ms 1 /classes/Product.php:2902
856 
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563427
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
 0.364 ms 1 /modules/an_wishlist/classes/an_wish.php:76
895 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.364 ms 1 /classes/stock/StockAvailable.php:753
956 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.364 ms 1 /classes/stock/StockAvailable.php:806
960 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6048
 0.364 ms 1 /classes/Product.php:2902
472 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 11299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.363 ms 1 /classes/stock/StockAvailable.php:453
842 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1949
 0.363 ms 3 /classes/Product.php:3423
977 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5603 LIMIT 1
 0.362 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
487 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.362 ms 1 /classes/Product.php:5639
525 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7937 AND id_shop=1 LIMIT 1
 0.362 ms 1 /classes/Product.php:6848
544 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 7361
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.362 ms 1 /classes/SpecificPrice.php:259
798 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1987) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.362 ms 1 /classes/stock/StockAvailable.php:778
1014 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.362 ms 1 /classes/stock/StockAvailable.php:778
56 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_productcomments" LIMIT 1
 0.361 ms 0 /classes/module/Module.php:2636
1076 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.361 ms 0 /classes/Smarty/SmartyCustom.php:216
604 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.360 ms 1 /classes/stock/StockAvailable.php:453
786 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 10978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.360 ms 1 /classes/stock/StockAvailable.php:778
1002 
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.360 ms 1 /classes/stock/StockAvailable.php:778
1015 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.360 ms 1 /classes/stock/StockAvailable.php:753
548 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7361 AND `id_group` = 1 LIMIT 1
 0.359 ms 0 /classes/GroupReduction.php:156
668 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8192
 0.359 ms 1 /classes/Product.php:2902
670 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6857
 0.359 ms 1 /classes/Product.php:2902
735 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_wishlist" LIMIT 1
 0.359 ms 1 /classes/module/Module.php:2636
723 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_client_service" LIMIT 1
 0.358 ms 1 /classes/module/Module.php:2636
364 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "stsearchbar" LIMIT 1
 0.358 ms 0 /classes/module/Module.php:2636
848 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1949) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.358 ms 1 /classes/stock/StockAvailable.php:806
896 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8277) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.358 ms 1 /classes/stock/StockAvailable.php:806
1089 
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 1) LIMIT 1
 0.358 ms 1 /src/Adapter/EntityMapper.php:71
932 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.357 ms 1 /classes/stock/StockAvailable.php:806
559 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6048 AND `id_group` = 1 LIMIT 1
 0.357 ms 0 /classes/GroupReduction.php:156
1052 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 403) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.357 ms 1 /classes/stock/StockAvailable.php:806
360 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labsearch" LIMIT 1
 0.356 ms 0 /classes/module/Module.php:2636
555 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.356 ms 1 /classes/SpecificPrice.php:259
1082 
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 6) LIMIT 1
 0.356 ms 1 /src/Adapter/EntityMapper.php:71
415 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1987 AND `id_group` = 1 LIMIT 1
 0.355 ms 0 /classes/GroupReduction.php:156
436 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6857 AND id_shop=1 LIMIT 1
 0.355 ms 1 /classes/Product.php:6848
726 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 125 AND `id_shop` = 1 LIMIT 1
 0.355 ms 1 /classes/module/Module.php:2109
878 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8861
 0.355 ms 3 /classes/Product.php:3423
678 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 9135
 0.354 ms 1 /classes/Product.php:2902
869 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 9135 LIMIT 1
 0.354 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
974 
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 5603
 0.354 ms 3 /classes/Product.php:3423
356 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ttblocksearch" LIMIT 1
 0.354 ms 0 /classes/module/Module.php:2636
775 
SELECT SQL_NO_CACHE `iso_code`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
 0.354 ms 1 /classes/Country.php:275
1013 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 5139 LIMIT 1
 0.354 ms 19 /modules/an_wishlist/classes/an_wish_products.php:124
684 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8043
 0.353 ms 1 /classes/Product.php:2902
372 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "spsearchpro" LIMIT 1
 0.353 ms 0 /classes/module/Module.php:2636
426 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8192 AND `id_group` = 1 LIMIT 1
 0.352 ms 0 /classes/GroupReduction.php:156
1105 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572873))
 0.352 ms 1 /classes/Smarty/SmartyCustom.php:265
538 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7733) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.351 ms 1 /classes/stock/StockAvailable.php:453
520 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.351 ms 1 /classes/Product.php:5639
592 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5479 AND `id_group` = 1 LIMIT 1
 0.351 ms 0 /classes/GroupReduction.php:156
593 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.351 ms 1 /classes/stock/StockAvailable.php:453
454 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.350 ms 1 /classes/Product.php:5639
722 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `mangayo_currency` c
LEFT JOIN mangayo_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.350 ms 1 /classes/Currency.php:1136
859 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 11299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.350 ms 1 /classes/stock/StockAvailable.php:753
741 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
 0.349 ms 1 /classes/module/Module.php:2109
1008 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5143
 0.349 ms 1 /classes/Product.php:2902
929 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7733 LIMIT 1
 0.348 ms 1 /modules/an_wishlist/classes/an_wish_products.php:124
1044 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4094
 0.348 ms 1 /classes/Product.php:2902
527 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 7937) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.347 ms 1 /classes/stock/StockAvailable.php:453
708 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 403
 0.347 ms 1 /classes/Product.php:2902
941 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 7361 LIMIT 1
 0.347 ms 15 /modules/an_wishlist/classes/an_wish_products.php:124
955 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.347 ms 1 /classes/stock/StockAvailable.php:753
504 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8277 AND `id_group` = 1 LIMIT 1
 0.346 ms 0 /classes/GroupReduction.php:156
1074 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_linklist" LIMIT 1
 0.346 ms 1 /classes/module/Module.php:2636
509 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.346 ms 1 /classes/Product.php:5639
608 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.346 ms 1 /classes/Product.php:5639
478 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 9135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.345 ms 1 /classes/SpecificPrice.php:259
515 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8043 AND `id_group` = 1 LIMIT 1
 0.345 ms 0 /classes/GroupReduction.php:156
702 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5139
 0.345 ms 1 /classes/Product.php:2902
712 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 76 AND `id_shop` = 1 LIMIT 1
 0.345 ms 1 /classes/module/Module.php:2109
1040 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.345 ms 1 /classes/stock/StockAvailable.php:806
363 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.344 ms 0 /classes/module/Module.php:2109
467 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 11299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.344 ms 1 /classes/SpecificPrice.php:259
591 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5479 AND id_shop=1 LIMIT 1
 0.344 ms 1 /classes/Product.php:6848
637 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.344 ms 1 /classes/stock/StockAvailable.php:453
570 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5773 AND `id_group` = 1 LIMIT 1
 0.344 ms 0 /classes/GroupReduction.php:156
676 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 11299
 0.344 ms 1 /classes/Product.php:2902
953 
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 6048 LIMIT 1
 0.344 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
526 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 7937 AND `id_group` = 1 LIMIT 1
 0.343 ms 0 /classes/GroupReduction.php:156
536 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7733 AND id_shop=1 LIMIT 1
 0.343 ms 1 /classes/Product.php:6848
777 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 10 AND `id_shop` = 1 LIMIT 1
 0.343 ms 1 /classes/module/Module.php:2109
968 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5773) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.343 ms 1 /classes/stock/StockAvailable.php:806
979 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.343 ms 1 /classes/stock/StockAvailable.php:753
1113 
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme" LIMIT 1
 0.343 ms 1 /classes/Smarty/SmartyCustom.php:216
433 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6857
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.342 ms 1 /classes/SpecificPrice.php:259
724 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 147 AND `id_shop` = 1 LIMIT 1
 0.342 ms 1 /classes/module/Module.php:2109
444 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 7
AND `active` = 1 LIMIT 1
 0.342 ms 1 /classes/Manufacturer.php:316
847 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1949) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.342 ms 1 /classes/stock/StockAvailable.php:753
1115 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572873))
 0.342 ms 1 /classes/Smarty/SmartyCustom.php:265
984 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5603
 0.341 ms 1 /classes/Product.php:2902
580 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5603 AND id_shop=1 LIMIT 1
 0.341 ms 1 /classes/Product.php:6848
625 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4673 AND `id_group` = 1 LIMIT 1
 0.341 ms 0 /classes/GroupReduction.php:156
558 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6048 AND id_shop=1 LIMIT 1
 0.340 ms 1 /classes/Product.php:6848
614 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5139 AND `id_group` = 1 LIMIT 1
 0.340 ms 0 /classes/GroupReduction.php:156
700 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5143
 0.340 ms 1 /classes/Product.php:2902
445 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 328
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.339 ms 1 /classes/SpecificPrice.php:259
470 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 11299 AND id_shop=1 LIMIT 1
 0.339 ms 1 /classes/Product.php:6848
482 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 9135 AND `id_group` = 1 LIMIT 1
 0.339 ms 0 /classes/GroupReduction.php:156
696 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5603
 0.339 ms 1 /classes/Product.php:2902
823 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6857) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.339 ms 1 /classes/stock/StockAvailable.php:753
437 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 6857 AND `id_group` = 1 LIMIT 1
 0.338 ms 0 /classes/GroupReduction.php:156
547 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 7361 AND id_shop=1 LIMIT 1
 0.338 ms 1 /classes/Product.php:6848
621 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4673
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.338 ms 1 /classes/SpecificPrice.php:259
734 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 15 AND `id_shop` = 1 LIMIT 1
 0.338 ms 1 /classes/module/Module.php:2109
409 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.337 ms 1 /classes/Product.php:5639
411 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1987
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.337 ms 1 /classes/SpecificPrice.php:259
688 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7733
 0.337 ms 1 /classes/Product.php:2902
654 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 6533
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.337 ms 1 /classes/SpecificPrice.php:259
686 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7937
 0.337 ms 1 /classes/Product.php:2902
1078 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572873))
 0.337 ms 1 /classes/Smarty/SmartyCustom.php:265
635 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4094 AND id_shop=1 LIMIT 1
 0.336 ms 1 /classes/Product.php:6848
736 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
 0.336 ms 1 /classes/module/Module.php:2109
483 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.335 ms 1 /classes/stock/StockAvailable.php:453
690 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 7361
 0.335 ms 1 /classes/Product.php:2902
1063 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.335 ms 1 /classes/stock/StockAvailable.php:753
1075 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
 0.335 ms 1 /classes/module/Module.php:2109
371 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.334 ms 0 /classes/module/Module.php:2109
449 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 328 AND `id_group` = 1 LIMIT 1
 0.334 ms 0 /classes/GroupReduction.php:156
613 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5139 AND id_shop=1 LIMIT 1
 0.334 ms 1 /classes/Product.php:6848
664 
SELECT SQL_NO_CACHE state FROM mangayo_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.334 ms 1 /classes/FeatureFlag.php:105
872 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 9135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.334 ms 1 /classes/stock/StockAvailable.php:806
992 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.334 ms 1 /classes/stock/StockAvailable.php:806
812 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.333 ms 1 /classes/stock/StockAvailable.php:806
657 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 6533 AND id_shop=1 LIMIT 1
 0.333 ms 1 /classes/Product.php:6848
514 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8043 AND id_shop=1 LIMIT 1
 0.332 ms 1 /classes/Product.php:6848
586 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.332 ms 1 /classes/Product.php:5639
1028 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.332 ms 1 /classes/stock/StockAvailable.php:806
448 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 328 AND id_shop=1 LIMIT 1
 0.331 ms 1 /classes/Product.php:6848
399 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 5
AND `active` = 1 LIMIT 1
 0.331 ms 1 /classes/Manufacturer.php:316
569 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5773 AND id_shop=1 LIMIT 1
 0.331 ms 1 /classes/Product.php:6848
725 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "darkmode" LIMIT 1
 0.331 ms 1 /classes/module/Module.php:2636
738 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_shoppingcart" LIMIT 1
 0.331 ms 1 /classes/module/Module.php:2636
1039 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4094) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.331 ms 1 /classes/stock/StockAvailable.php:753
465 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.329 ms 1 /classes/Product.php:5639
944 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.329 ms 1 /classes/stock/StockAvailable.php:806
460 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1949 AND `id_group` = 1 LIMIT 1
 0.328 ms 0 /classes/GroupReduction.php:156
492 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8861 AND id_shop=1 LIMIT 1
 0.328 ms 1 /classes/Product.php:6848
503 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8277 AND id_shop=1 LIMIT 1
 0.328 ms 1 /classes/Product.php:6848
710 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6533
 0.328 ms 1 /classes/Product.php:2902
780 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.328 ms 1 /classes/module/Module.php:2109
811 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.328 ms 1 /classes/stock/StockAvailable.php:753
659 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.327 ms 1 /classes/stock/StockAvailable.php:453
716 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_simplefreeshippingline" LIMIT 1
 0.327 ms 1 /classes/module/Module.php:2636
991 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 5479) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.327 ms 1 /classes/stock/StockAvailable.php:753
626 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.326 ms 1 /classes/stock/StockAvailable.php:453
943 
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 7361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.326 ms 1 /classes/stock/StockAvailable.php:753
500 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8277
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.325 ms 1 /classes/SpecificPrice.php:259
663 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 10978
 0.325 ms 1 /classes/Product.php:2902
860 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 11299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.325 ms 1 /classes/stock/StockAvailable.php:806
718 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.324 ms 1 /classes/module/Module.php:2636
1004 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 5143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.324 ms 1 /classes/stock/StockAvailable.php:806
471 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 11299 AND `id_group` = 1 LIMIT 1
 0.323 ms 0 /classes/GroupReduction.php:156
542 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.323 ms 1 /classes/Product.php:5639
1116 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572873))
 0.323 ms 1 /classes/Smarty/SmartyCustom.php:265
1064 
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 6533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.322 ms 1 /classes/stock/StockAvailable.php:806
405 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 10978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.322 ms 1 /classes/stock/StockAvailable.php:453
648 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 403) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.321 ms 1 /classes/stock/StockAvailable.php:453
680 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8861
 0.321 ms 1 /classes/Product.php:2902
739 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
 0.321 ms 1 /classes/module/Module.php:2109
400 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 10978
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.320 ms 1 /classes/SpecificPrice.php:259
531 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.320 ms 1 /classes/Product.php:5639
581 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5603 AND `id_group` = 1 LIMIT 1
 0.319 ms 0 /classes/GroupReduction.php:156
698 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5479
 0.318 ms 1 /classes/Product.php:2902
1121 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 150 AND `id_shop` = 1 LIMIT 1
 0.316 ms 1 /classes/module/Module.php:2109
704 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4673
 0.316 ms 1 /classes/Product.php:2902
597 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.315 ms 1 /classes/Product.php:5639
422 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8192
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.314 ms 1 /classes/SpecificPrice.php:259
553 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.314 ms 1 /classes/Product.php:5639
674 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1949
 0.313 ms 1 /classes/Product.php:2902
493 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8861 AND `id_group` = 1 LIMIT 1
 0.312 ms 0 /classes/GroupReduction.php:156
498 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.312 ms 1 /classes/Product.php:5639
582 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5603) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.312 ms 1 /classes/stock/StockAvailable.php:453
615 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 5139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.312 ms 1 /classes/stock/StockAvailable.php:453
714 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 117 LIMIT 1
 0.312 ms 1 /classes/Hook.php:244
516 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.309 ms 1 /classes/stock/StockAvailable.php:453
692 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 6048
 0.309 ms 1 /classes/Product.php:2902
720 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.309 ms 1 /classes/module/Module.php:2636
641 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.308 ms 1 /classes/Product.php:5639
564 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.307 ms 1 /classes/Product.php:5639
630 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.306 ms 1 /classes/Product.php:5639
481 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 9135 AND id_shop=1 LIMIT 1
 0.303 ms 1 /classes/Product.php:6848
646 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 403 AND id_shop=1 LIMIT 1
 0.301 ms 1 /classes/Product.php:6848
652 
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
 0.301 ms 1 /classes/Product.php:5639
636 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4094 AND `id_group` = 1 LIMIT 1
 0.299 ms 0 /classes/GroupReduction.php:156
694 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 5773
 0.299 ms 1 /classes/Product.php:2902
602 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 5143 AND id_shop=1 LIMIT 1
 0.298 ms 1 /classes/Product.php:6848
603 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 5143 AND `id_group` = 1 LIMIT 1
 0.297 ms 0 /classes/GroupReduction.php:156
715 
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 48 LIMIT 1
 0.297 ms 1 /classes/Hook.php:244
647 
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 403 AND `id_group` = 1 LIMIT 1
 0.295 ms 0 /classes/GroupReduction.php:156
719 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
 0.293 ms 1 /classes/module/Module.php:2109
721 
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
 0.279 ms 1 /classes/module/Module.php:2109

Doubles

48 queries 
SELECT image_shop.`id_image`
                    FROM `mangayo_image` i
                     INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries 
SELECT name FROM mangayo_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries 
SELECT *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `mangayo_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
48 queries 
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `mangayo_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
48 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries 
                            SELECT `id_tax_rules_group`
                            FROM `mangayo_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries 
			SELECT `reduction`
			FROM `mangayo_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries 
SELECT SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `mangayo_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM mangayo_feature_product pf
                LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN mangayo_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
48 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `mangayo_image` i
             INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
48 queries 
SELECT `id_product_attribute`
            FROM `mangayo_product_attribute`
            WHERE `id_product` = XX
34 queries 
SELECT `id_module` FROM `mangayo_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
25 queries 
            SELECT `id_wishlist`
            FROM `mangayo_an_wishlist`
            WHERE `id_customer` = XX
            AND `is_guest` = XX
            AND `id_shop` = XX LIMIT XX
24 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `mangayo_product_attribute` pa
             INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
24 queries 
                SELECT `id_category` FROM `mangayo_category_product`
                WHERE `id_product` = XX
24 queries 
            SELECT COUNT(*)
            FROM `mangayo_an_wishlist_products`
            WHERE `id_product` = XX LIMIT XX
24 queries 
SELECT out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT location
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT product_attribute_shop.id_product_attribute
                FROM mangayo_product_attribute pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries 
SELECT ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
                    a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
                    IFNULL(stock.quantity, XX) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
                    product_attribute_shop.`default_on`, pa.`reference`, pa.`eanXX`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
                    product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
                    pal.`available_now`, pal.`available_later`
                FROM `mangayo_product_attribute` pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
                LEFT JOIN `mangayo_product_attribute_lang` pal
                    ON (
                        pa.`id_product_attribute` = pal.`id_product_attribute` AND
                        pal.`id_lang` = XX)
                LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
                LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
                LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
                 INNER JOIN mangayo_attribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX)
                WHERE pa.`id_product` = XX
                    AND al.`id_lang` = XX
                    AND agl.`id_lang` = XX
                GROUP BY id_attribute_group, id_product_attribute
                ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
20 queries 
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
14 queries 
SELECT *
            FROM `mangayo_andropdown` d
            LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
            WHERE d.`id_anmenu` = XX
            AND `id_lang` = XX
            AND `active` = XX
            GROUP BY d.`id_andropdown`
            ORDER BY d.`position` ASC
10 queries 
SELECT *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = XX
WHERE (a.`id_cms` = XX) LIMIT XX
10 queries 
SELECT *
							FROM `mangayo_cms_lang`
							WHERE `id_cms` = XX AND `id_shop` = XX
6 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"an_megamenu|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
4 queries 
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries 
SELECT *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
3 queries 
							SELECT `name`
							FROM `mangayo_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_linklist|displayFooter|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
3 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_customeraccountlinks|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
2 queries 
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `mangayo_module` m
                LEFT JOIN `mangayo_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries 
SELECT `id_lang` FROM `mangayo_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries 
SELECT XX FROM `mangayo_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries 
			SELECT `need_identification_number`
			FROM `mangayo_country`
			WHERE `id_country` = XX LIMIT XX
2 queries 
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
2 queries 
			SELECT cl.`link_rewrite`
			FROM `mangayo_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
2 queries 
				SELECT tr.*
				FROM `mangayo_tax_rule` tr
				JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
SELECT c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = XX) LIMIT XX
2 queries 
				SELECT `name`
				FROM `mangayo_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries 
SELECT `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=XX) AND (`active`= XX)
2 queries 
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
2 queries 
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="" AND compile_id="charme" LIMIT XX
2 queries 
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"","charme", FROM_UNIXTIME(XX))
2 queries 
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="an_megamenu|XX|XX|XX|XX" AND compile_id="charme" LIMIT XX
2 queries 
SELECT *
            FROM `mangayo_anmenu` m
            LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
            
            WHERE m.`id_shop` = XX
            AND `id_lang` = XX
            AND `active` = XX
            
            GROUP BY m.`id_anmenu`
            ORDER BY m.`position` ASC
2 queries 
SELECT m.*, ml.`description`, ml.`short_description`
            FROM `mangayo_manufacturer` m
             INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)
            LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)
            WHERE m.`id_manufacturer` IN (XX)
            AND m.`active` = XX
            GROUP BY m.`id_manufacturer`
            ORDER BY m.`name`
2 queries 
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) as quantity, pl.`description`,
            pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
            pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
            m.`name` AS manufacturer_name,
            DATEDIFF(
                product_shop.`date_add`,
                DATE_SUB(
                    NOW(),
                    INTERVAL XX DAY
                )
            ) > XX AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
 INNER JOIN mangayo_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = XX AND pl.id_shop = XX 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
 LEFT JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX AND image_shop.cover=XX)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = XX
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
 LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX AND product_attribute_shop.default_on = XX)
 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
WHERE (p.`id_product` IN (XX))
GROUP BY product_shop.id_product
2 queries 
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
2 queries 
SELECT *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = XX
WHERE (a.`id_link_block` = XX) LIMIT XX
2 queries 
SELECT *
							FROM `mangayo_link_block_lang`
							WHERE `id_link_block` = XX

Tables stress

158 product
157 product_shop
155 stock_available
129 product_attribute
123 product_attribute_shop
99 image_shop
98 image
97 cart_product
71 feature_product
62 category_lang
55 product_attribute_combination
53 product_lang
52 specific_price
52 feature_value_lang
51 image_lang
49 feature_lang
49 feature
49 feature_shop
48 specific_price_priority
48 product_group_reduction_cache
48 pack
48 attribute
48 attribute_lang
48 attribute_group
44 module
37 module_shop
35 category_product
25 an_wishlist
24 an_productextratabs_labels_relations
24 an_productextratabs_labels_lang
24 an_wishlist_products
24 product_attribute_lang
24 attribute_group_lang
24 attribute_shop
21 category
14 andropdown
14 andropdown_lang
11 category_group
10 hook
10 category_shop
10 cms
10 cms_shop
10 cms_lang
9 manufacturer
6 product_sale
6 smarty_lazy_cache
5 lang
5 country
5 currency
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 manufacturer_shop
4 manufacturer_lang
4 feature_value
4 layered_indexable_feature_value_lang_value
3 hook_alias
3 image_type
3 link_block
3 link_block_shop
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 cart_rule_lang
2 smarty_last_flush
2 tax_rule
2 tax_rules_group
2 social_login_position
2 anmenu
2 anmenu_lang
2 link_block_lang
2 date_range
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 group_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 orders
1 hicookietype
1 hicookietype_lang
1 hicookietype_shop
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 dark_mode
1 an_trust_badges_widgets
1 an_trust_badges_widgets_lang
1 an_trust_badges_icons
1 connections
1 page_type
1 page
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 145 /classes/Link.php:113 (__construct) [id: 284]
/classes/Link.php:113 (__construct) [id: 285]
/classes/Link.php:113 (__construct) [id: 286]
/classes/Link.php:113 (__construct) [id: 287]
/classes/Link.php:113 (__construct) [id: 288]
/classes/Link.php:113 (__construct) [id: 289]
/classes/Link.php:113 (__construct) [id: 290]
/classes/Link.php:113 (__construct) [id: 291]
/classes/Link.php:113 (__construct) [id: 292]
/classes/Link.php:113 (__construct) [id: 293]
/classes/Link.php:113 (__construct) [id: 294]
/classes/Link.php:113 (__construct) [id: 295]
/classes/Link.php:113 (__construct) [id: 296]
/classes/Link.php:113 (__construct) [id: 297]
/classes/Link.php:113 (__construct) [id: 298]
/classes/Link.php:113 (__construct) [id: 299]
/classes/Link.php:113 (__construct) [id: 300]
/classes/Link.php:113 (__construct) [id: 301]
/classes/Link.php:113 (__construct) [id: 302]
/classes/Link.php:113 (__construct) [id: 303]
/classes/Link.php:113 (__construct) [id: 304]
/classes/Link.php:113 (__construct) [id: 305]
/classes/Link.php:113 (__construct) [id: 306]
/classes/Link.php:113 (__construct) [id: 307]
/modules/codwfeeplus/codwfeeplus.php:410 (__construct) [id: 12211]
/classes/Link.php:113 (__construct) [id: 10978]
/classes/Link.php:113 (__construct) [id: 1987]
/classes/Link.php:113 (__construct) [id: 8192]
/classes/Link.php:113 (__construct) [id: 6857]
/classes/Link.php:113 (__construct) [id: 328]
/classes/Link.php:113 (__construct) [id: 1949]
/classes/Link.php:113 (__construct) [id: 11299]
/classes/Link.php:113 (__construct) [id: 9135]
/classes/Link.php:113 (__construct) [id: 8861]
/classes/Link.php:113 (__construct) [id: 8277]
/classes/Link.php:113 (__construct) [id: 8043]
/classes/Link.php:113 (__construct) [id: 7937]
/classes/Link.php:113 (__construct) [id: 7733]
/classes/Link.php:113 (__construct) [id: 7361]
/classes/Link.php:113 (__construct) [id: 6048]
/classes/Link.php:113 (__construct) [id: 5773]
/classes/Link.php:113 (__construct) [id: 5603]
/classes/Link.php:113 (__construct) [id: 5479]
/classes/Link.php:113 (__construct) [id: 5143]
/classes/Link.php:113 (__construct) [id: 5139]
/classes/Link.php:113 (__construct) [id: 4673]
/classes/Link.php:113 (__construct) [id: 4094]
/classes/Link.php:113 (__construct) [id: 403]
/classes/Link.php:113 (__construct) [id: 6533]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10978]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1987]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8192]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6857]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 328]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1949]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 11299]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 9135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8861]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8277]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7937]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7733]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 7361]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5773]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5603]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5479]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5143]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5139]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4673]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4094]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 403]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6533]
/classes/Link.php:113 (__construct) [id: 10978]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 10978]
/classes/Link.php:113 (__construct) [id: 10978]
/classes/Link.php:113 (__construct) [id: 1987]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1987]
/classes/Link.php:113 (__construct) [id: 1987]
/classes/Link.php:113 (__construct) [id: 8192]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8192]
/classes/Link.php:113 (__construct) [id: 8192]
/classes/Link.php:113 (__construct) [id: 6857]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6857]
/classes/Link.php:113 (__construct) [id: 6857]
/classes/Link.php:113 (__construct) [id: 328]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 328]
/classes/Link.php:113 (__construct) [id: 328]
/classes/Link.php:113 (__construct) [id: 1949]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1949]
/classes/Link.php:113 (__construct) [id: 1949]
/classes/Link.php:113 (__construct) [id: 11299]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 11299]
/classes/Link.php:113 (__construct) [id: 11299]
/classes/Link.php:113 (__construct) [id: 9135]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 9135]
/classes/Link.php:113 (__construct) [id: 9135]
/classes/Link.php:113 (__construct) [id: 8861]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8861]
/classes/Link.php:113 (__construct) [id: 8861]
/classes/Link.php:113 (__construct) [id: 8277]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8277]
/classes/Link.php:113 (__construct) [id: 8277]
/classes/Link.php:113 (__construct) [id: 8043]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8043]
/classes/Link.php:113 (__construct) [id: 8043]
/classes/Link.php:113 (__construct) [id: 7937]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7937]
/classes/Link.php:113 (__construct) [id: 7937]
/classes/Link.php:113 (__construct) [id: 7733]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7733]
/classes/Link.php:113 (__construct) [id: 7733]
/classes/Link.php:113 (__construct) [id: 7361]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 7361]
/classes/Link.php:113 (__construct) [id: 7361]
/classes/Link.php:113 (__construct) [id: 6048]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6048]
/classes/Link.php:113 (__construct) [id: 6048]
/classes/Link.php:113 (__construct) [id: 5773]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5773]
/classes/Link.php:113 (__construct) [id: 5773]
/classes/Link.php:113 (__construct) [id: 5603]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5603]
/classes/Link.php:113 (__construct) [id: 5603]
/classes/Link.php:113 (__construct) [id: 5479]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5479]
/classes/Link.php:113 (__construct) [id: 5479]
/classes/Link.php:113 (__construct) [id: 5143]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5143]
/classes/Link.php:113 (__construct) [id: 5143]
/classes/Link.php:113 (__construct) [id: 5139]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 5139]
/classes/Link.php:113 (__construct) [id: 5139]
/classes/Link.php:113 (__construct) [id: 4673]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4673]
/classes/Link.php:113 (__construct) [id: 4673]
/classes/Link.php:113 (__construct) [id: 4094]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4094]
/classes/Link.php:113 (__construct) [id: 4094]
/classes/Link.php:113 (__construct) [id: 403]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 403]
/classes/Link.php:113 (__construct) [id: 403]
/classes/Link.php:113 (__construct) [id: 6533]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 6533]
/classes/Link.php:113 (__construct) [id: 6533]
CMS 11 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 0]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 16]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 3]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 1]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 19]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 8]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 9]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 10]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 11]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 15]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 23]
Category 11 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 88]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 90]
/classes/Meta.php:380 (__construct) [id: 11]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/facebookproductad/lib/pixel/pixelCategory.php:46 (__construct) [id: 11]
/modules/facebookproductad/lib/moduleTools.php:481 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 11]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 11]
Country 7 /config/config.inc.php:146 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1725 (__construct) [id: 10]
/modules/paypal/paypal.php:324 (__construct) [id: 10]
/modules/paypal/classes/AbstractMethodPaypal.php:90 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/modules/ps_contactinfo/ps_contactinfo.php:104 (__construct) [id: 10]
State 5 /classes/AddressFormat.php:404 (__construct) [id: 211]
/classes/controller/FrontController.php:1724 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:93 (__construct) [id: 211]
/classes/AddressFormat.php:404 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:103 (__construct) [id: 211]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3691 (initialize) [id: ]
/classes/Product.php:3801 (__construct) [id: ]
/classes/Product.php:5936 (__construct) [id: ]
Language 4 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:559 (__construct) [id: 1]
/modules/facebookproductad/lib/hook/hookDisplay.php:90 (__construct) [id: 1]
/modules/facebookproductad/lib/pixel/pixelCategory.php:39 (__construct) [id: 1]
Cart 4 /classes/controller/FrontController.php:429 (__construct) [id: ]
/classes/controller/FrontController.php:499 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
AddressFormat 2 /classes/controller/FrontController.php:1719 (generateAddress) [id: ]
/modules/ps_contactinfo/ps_contactinfo.php:98 (generateAddress) [id: ]
Carrier 2 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
PrestaShop\Module\LinkList\Model\LinkBlock 2 /modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 1]
/modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 6]
BoldizArt\DarkMode\Model\DarkModeOptionsModel 2 /modules/darkmode/darkmode.php:227 (__construct) [id: 1]
/modules/darkmode/darkmode.php:227 (__construct) [id: 1]
OrderState 2 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:684 (getCurrencyInstance) [id: 1]
Hook 2 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
Configuration 2 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
ImageType 1 /modules/an_brandslider/an_brandslider.php:440 (__construct) [id: 14]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Risk 1 /classes/controller/FrontController.php:1652 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1649 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/api-platform/core/src/deprecation.php
40 /vendor/api-platform/core/src/Api/FilterInterface.php
41 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
42 /vendor/api-platform/core/src/deprecated_interfaces.php
43 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
58 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
61 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
62 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
65 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
66 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
67 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
68 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
69 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
70 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
71 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
72 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
73 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
74 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
75 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
76 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
77 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
78 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
88 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
89 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
97 /vendor/psr/container/src/ContainerInterface.php
98 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
99 /vendor/ircmaxell/password-compat/lib/password.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /classes/Smarty/SmartyCustom.php
196 /vendor/smarty/smarty/libs/Smarty.class.php
197 /vendor/smarty/smarty/libs/functions.php
198 /vendor/smarty/smarty/libs/Autoloader.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
208 /config/smartyfront.config.inc.php
209 /classes/Smarty/SmartyResourceModule.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
212 /classes/Smarty/SmartyResourceParent.php
213 /classes/Smarty/SmartyLazyRegister.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
215 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
216 /classes/Customer.php
217 /classes/Group.php
218 /classes/Link.php
219 /classes/shop/ShopUrl.php
220 /classes/Dispatcher.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
228 /src/Adapter/SymfonyContainer.php
229 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
230 /config/db_slave_server.inc.php
231 /modules/anblog/anblog.php
232 /modules/anblog/loader.php
233 /modules/anblog/classes/config.php
234 /modules/anblog/config.php
235 /modules/anblog/libs/Helper.php
236 /modules/anblog/libs/AnblogImage.php
237 /modules/anblog/classes/anBlogLikes.php
238 /modules/anblog/classes/anblogcat.php
239 /modules/anblog/classes/blog.php
240 /modules/anblog/classes/link.php
241 /modules/anblog/classes/comment.php
242 /modules/anblog/classes/sitemap.php
243 /modules/anblog/classes/anBlogWidgets.php
244 /src/Core/Security/Hashing.php
245 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
246 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
247 /classes/Translate.php
248 /modules/anblog/translations/it.php
249 /src/PrestaShopBundle/Translation/TranslatorComponent.php
250 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
251 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
252 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
253 /vendor/symfony/contracts/Translation/TranslatorInterface.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
255 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
256 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
257 /src/PrestaShopBundle/Translation/TranslatorInterface.php
258 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
259 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
260 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
264 /vendor/symfony/contracts/Translation/TranslatorTrait.php
265 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
266 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
267 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
268 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
269 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
270 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
274 /override/controllers/front/listing/CategoryController.php
275 /controllers/front/listing/CategoryController.php
276 /classes/controller/ProductListingFrontController.php
277 /classes/controller/ProductPresentingFrontController.php
278 /classes/controller/FrontController.php
279 /src/Adapter/Presenter/Object/ObjectPresenter.php
280 /src/Adapter/Presenter/PresenterInterface.php
281 /src/Adapter/Presenter/Cart/CartPresenter.php
282 /src/Adapter/Product/PriceFormatter.php
283 /src/Adapter/Image/ImageRetriever.php
284 /classes/tax/TaxConfiguration.php
285 /classes/Smarty/TemplateFinder.php
286 /classes/assets/StylesheetManager.php
287 /classes/assets/AbstractAssetManager.php
288 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
289 /classes/assets/JavascriptManager.php
290 /classes/assets/CccReducer.php
291 /classes/Category.php
292 /classes/webservice/WebserviceRequest.php
293 /src/Adapter/ContainerBuilder.php
294 /src/Adapter/Environment.php
295 /src/Core/EnvironmentInterface.php
296 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
297 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
298 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
299 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
300 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
301 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
302 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
303 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
304 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
305 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
306 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
308 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
309 /vendor/symfony/contracts/Service/ResetInterface.php
310 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
311 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
312 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
313 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
314 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
315 /vendor/symfony/contracts/Cache/ItemInterface.php
316 /vendor/psr/cache/src/CacheItemInterface.php
317 /vendor/psr/cache/src/CacheItemPoolInterface.php
318 /vendor/symfony/contracts/Cache/CacheInterface.php
319 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
321 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
323 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
324 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
325 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
326 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
328 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
330 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
332 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
333 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
334 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
335 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
380 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
381 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
382 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
383 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
384 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
387 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
388 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
389 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
390 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
391 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
392 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
393 /var/cache/dev/FrontContainer.php
394 /src/Adapter/Container/LegacyContainer.php
395 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
396 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
397 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
399 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
400 /vendor/psr/container/src/ContainerExceptionInterface.php
401 /vendor/psr/container/src/NotFoundExceptionInterface.php
402 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
404 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
405 /src/Adapter/Container/LegacyContainerInterface.php
406 /modules/contactform/vendor/autoload.php
407 /modules/contactform/vendor/composer/autoload_real.php
408 /modules/contactform/vendor/composer/autoload_static.php
409 /modules/dashactivity/vendor/autoload.php
410 /modules/dashactivity/vendor/composer/autoload_real.php
411 /modules/dashactivity/vendor/composer/autoload_static.php
412 /modules/dashtrends/vendor/autoload.php
413 /modules/dashtrends/vendor/composer/autoload_real.php
414 /modules/dashtrends/vendor/composer/autoload_static.php
415 /modules/dashproducts/vendor/autoload.php
416 /modules/dashproducts/vendor/composer/autoload_real.php
417 /modules/dashproducts/vendor/composer/autoload_static.php
418 /modules/graphnvd3/vendor/autoload.php
419 /modules/graphnvd3/vendor/composer/autoload_real.php
420 /modules/graphnvd3/vendor/composer/autoload_static.php
421 /modules/gridhtml/vendor/autoload.php
422 /modules/gridhtml/vendor/composer/autoload_real.php
423 /modules/gridhtml/vendor/composer/autoload_static.php
424 /modules/ps_banner/vendor/autoload.php
425 /modules/ps_banner/vendor/composer/autoload_real.php
426 /modules/ps_banner/vendor/composer/platform_check.php
427 /modules/ps_banner/vendor/composer/autoload_static.php
428 /modules/ps_categorytree/vendor/autoload.php
429 /modules/ps_categorytree/vendor/composer/autoload_real.php
430 /modules/ps_categorytree/vendor/composer/platform_check.php
431 /modules/ps_categorytree/vendor/composer/autoload_static.php
432 /modules/ps_contactinfo/vendor/autoload.php
433 /modules/ps_contactinfo/vendor/composer/autoload_real.php
434 /modules/ps_contactinfo/vendor/composer/platform_check.php
435 /modules/ps_contactinfo/vendor/composer/autoload_static.php
436 /modules/ps_currencyselector/vendor/autoload.php
437 /modules/ps_currencyselector/vendor/composer/autoload_real.php
438 /modules/ps_currencyselector/vendor/composer/platform_check.php
439 /modules/ps_currencyselector/vendor/composer/autoload_static.php
440 /modules/ps_customeraccountlinks/vendor/autoload.php
441 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
442 /modules/ps_customeraccountlinks/vendor/composer/platform_check.php
443 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
444 /modules/ps_customersignin/vendor/autoload.php
445 /modules/ps_customersignin/vendor/composer/autoload_real.php
446 /modules/ps_customersignin/vendor/composer/platform_check.php
447 /modules/ps_customersignin/vendor/composer/autoload_static.php
448 /modules/ps_customtext/vendor/autoload.php
449 /modules/ps_customtext/vendor/composer/autoload_real.php
450 /modules/ps_customtext/vendor/composer/platform_check.php
451 /modules/ps_customtext/vendor/composer/autoload_static.php
452 /modules/ps_emailsubscription/vendor/autoload.php
453 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
454 /modules/ps_emailsubscription/vendor/composer/platform_check.php
455 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
456 /modules/ps_faviconnotificationbo/vendor/autoload.php
457 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
458 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
459 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
460 /modules/ps_featuredproducts/vendor/autoload.php
461 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
462 /modules/ps_featuredproducts/vendor/composer/platform_check.php
463 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
464 /modules/ps_languageselector/vendor/autoload.php
465 /modules/ps_languageselector/vendor/composer/autoload_real.php
466 /modules/ps_languageselector/vendor/composer/platform_check.php
467 /modules/ps_languageselector/vendor/composer/autoload_static.php
468 /modules/ps_linklist/vendor/autoload.php
469 /modules/ps_linklist/vendor/composer/autoload_real.php
470 /modules/ps_linklist/vendor/composer/platform_check.php
471 /modules/ps_linklist/vendor/composer/autoload_static.php
472 /modules/ps_mainmenu/vendor/autoload.php
473 /modules/ps_mainmenu/vendor/composer/autoload_real.php
474 /modules/ps_mainmenu/vendor/composer/platform_check.php
475 /modules/ps_mainmenu/vendor/composer/autoload_static.php
476 /modules/ps_searchbar/vendor/autoload.php
477 /modules/ps_searchbar/vendor/composer/autoload_real.php
478 /modules/ps_searchbar/vendor/composer/platform_check.php
479 /modules/ps_searchbar/vendor/composer/autoload_static.php
480 /modules/ps_sharebuttons/vendor/autoload.php
481 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
482 /modules/ps_sharebuttons/vendor/composer/platform_check.php
483 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
484 /modules/ps_shoppingcart/vendor/autoload.php
485 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
486 /modules/ps_shoppingcart/vendor/composer/platform_check.php
487 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
488 /modules/ps_socialfollow/vendor/autoload.php
489 /modules/ps_socialfollow/vendor/composer/autoload_real.php
490 /modules/ps_socialfollow/vendor/composer/platform_check.php
491 /modules/ps_socialfollow/vendor/composer/autoload_static.php
492 /modules/ps_themecusto/vendor/autoload.php
493 /modules/ps_themecusto/vendor/composer/autoload_real.php
494 /modules/ps_themecusto/vendor/composer/platform_check.php
495 /modules/ps_themecusto/vendor/composer/autoload_static.php
496 /modules/pagesnotfound/vendor/autoload.php
497 /modules/pagesnotfound/vendor/composer/autoload_real.php
498 /modules/pagesnotfound/vendor/composer/autoload_static.php
499 /modules/psgdpr/vendor/autoload.php
500 /modules/psgdpr/vendor/composer/autoload_real.php
501 /modules/psgdpr/vendor/composer/autoload_static.php
502 /modules/ps_facetedsearch/vendor/autoload.php
503 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
505 /modules/ps_categoryproducts/vendor/autoload.php
506 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
507 /modules/ps_categoryproducts/vendor/composer/platform_check.php
508 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
509 /modules/ps_viewedproduct/vendor/autoload.php
510 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
511 /modules/ps_viewedproduct/vendor/composer/platform_check.php
512 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
513 /modules/ps_crossselling/vendor/autoload.php
514 /modules/ps_crossselling/vendor/composer/autoload_real.php
515 /modules/ps_crossselling/vendor/composer/platform_check.php
516 /modules/ps_crossselling/vendor/composer/autoload_static.php
517 /modules/ps_bestsellers/vendor/autoload.php
518 /modules/ps_bestsellers/vendor/composer/autoload_real.php
519 /modules/ps_bestsellers/vendor/composer/platform_check.php
520 /modules/ps_bestsellers/vendor/composer/autoload_static.php
521 /modules/ps_dataprivacy/vendor/autoload.php
522 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
523 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
524 /modules/sociallogin/vendor/autoload.php
525 /modules/sociallogin/vendor/composer/autoload_real.php
526 /modules/sociallogin/vendor/composer/autoload_static.php
527 /modules/sociallogin/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
528 /modules/eicaptcha/vendor/autoload.php
529 /modules/eicaptcha/vendor/composer/autoload_real.php
530 /modules/eicaptcha/vendor/composer/platform_check.php
531 /modules/eicaptcha/vendor/composer/autoload_static.php
532 /modules/eicaptcha/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
533 /modules/eicaptcha/vendor/symfony/string/Resources/functions.php
534 /modules/paypal/vendor/autoload.php
535 /modules/paypal/vendor/composer/autoload_real.php
536 /modules/paypal/vendor/composer/autoload_static.php
537 /modules/paypal/vendor/paragonie/random_compat/lib/random.php
538 /modules/paypal/vendor/symfony/polyfill-php70/bootstrap.php
539 /modules/paypal/vendor/guzzlehttp/psr7/src/functions_include.php
540 /modules/paypal/vendor/guzzlehttp/psr7/src/functions.php
541 /modules/ps_emailalerts/vendor/autoload.php
542 /modules/ps_emailalerts/vendor/composer/autoload_real.php
543 /modules/ps_emailalerts/vendor/composer/platform_check.php
544 /modules/ps_emailalerts/vendor/composer/autoload_static.php
545 /modules/darkmode/vendor/autoload.php
546 /modules/darkmode/vendor/composer/autoload_real.php
547 /modules/darkmode/vendor/composer/platform_check.php
548 /modules/darkmode/vendor/composer/autoload_static.php
549 /modules/payplug/vendor/autoload.php
550 /modules/payplug/vendor/composer/autoload_real.php
551 /modules/payplug/vendor/composer/autoload_static.php
552 /modules/app_endpoint/vendor/autoload.php
553 /modules/app_endpoint/vendor/composer/autoload_real.php
554 /modules/app_endpoint/vendor/composer/platform_check.php
555 /modules/app_endpoint/vendor/composer/autoload_static.php
556 /modules/autoupgrade/vendor/autoload.php
557 /modules/autoupgrade/vendor/composer/autoload_real.php
558 /modules/autoupgrade/vendor/composer/autoload_static.php
559 /modules/ps_specials/vendor/autoload.php
560 /modules/ps_specials/vendor/composer/autoload_real.php
561 /modules/ps_specials/vendor/composer/autoload_static.php
562 /modules/mangayo_assistant/vendor/autoload.php
563 /modules/mangayo_assistant/vendor/composer/autoload_real.php
564 /modules/mangayo_assistant/vendor/composer/autoload_static.php
565 /src/Core/Localization/Locale/Repository.php
566 /src/Core/Localization/Locale/RepositoryInterface.php
567 /src/Core/Localization/CLDR/LocaleRepository.php
568 /src/Core/Localization/CLDR/LocaleDataSource.php
569 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
570 /src/Core/Data/Layer/AbstractDataLayer.php
571 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
572 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
573 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
574 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
575 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
576 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
577 /vendor/symfony/contracts/Cache/CacheTrait.php
578 /vendor/psr/cache/src/InvalidArgumentException.php
579 /vendor/psr/cache/src/CacheException.php
580 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
584 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
585 /src/Core/Localization/CLDR/Reader.php
586 /src/Core/Localization/CLDR/ReaderInterface.php
587 /src/Core/Localization/Currency/Repository.php
588 /src/Core/Localization/Currency/RepositoryInterface.php
589 /src/Core/Localization/Currency/CurrencyDataSource.php
590 /src/Core/Localization/Currency/DataSourceInterface.php
591 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
592 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
593 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
594 /src/Adapter/Currency/CurrencyDataProvider.php
595 /src/Core/Currency/CurrencyDataProviderInterface.php
596 /src/Adapter/LegacyContext.php
597 /src/Adapter/Tools.php
598 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
599 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
600 /vendor/prestashop/decimal/src/Operation/Rounding.php
601 /src/Core/Localization/Locale.php
602 /src/Core/Localization/LocaleInterface.php
603 /src/Core/Localization/Specification/Price.php
604 /src/Core/Localization/Specification/Number.php
605 /src/Core/Localization/Specification/NumberInterface.php
606 /src/Core/Localization/Specification/Factory.php
607 /src/Core/Localization/CLDR/LocaleData.php
608 /src/Core/Localization/CLDR/NumberSymbolsData.php
609 /src/Core/Localization/CLDR/CurrencyData.php
610 /src/Core/Localization/CLDR/Locale.php
611 /src/Core/Localization/CLDR/LocaleInterface.php
612 /src/Core/Localization/Specification/NumberSymbolList.php
613 /classes/Currency.php
614 /src/Core/Localization/Currency/LocalizedCurrencyId.php
615 /src/Core/Localization/Currency/CurrencyData.php
616 /src/Core/Localization/Currency/CurrencyCollection.php
617 /src/Core/Localization/Currency.php
618 /src/Core/Localization/CurrencyInterface.php
619 /src/Core/Localization/Specification/NumberCollection.php
620 /src/Core/Localization/Number/Formatter.php
621 /classes/Cart.php
622 /src/Adapter/AddressFactory.php
623 /classes/CartRule.php
624 /classes/Product.php
625 /src/Core/Domain/Product/ValueObject/RedirectType.php
626 /src/Core/Util/DateTime/DateTime.php
627 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
628 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
629 /src/Core/Domain/Product/ValueObject/ProductType.php
630 /src/Core/Domain/Product/ValueObject/Reference.php
631 /src/Core/Domain/Product/ValueObject/Ean13.php
632 /src/Core/Domain/Product/ValueObject/Isbn.php
633 /src/Core/Domain/Product/ValueObject/Upc.php
634 /src/Core/Domain/Product/ProductSettings.php
635 /src/Core/Domain/Shop/ValueObject/ShopId.php
636 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
637 /modules/ps_emailsubscription/ps_emailsubscription.php
638 /src/Core/Module/WidgetInterface.php
639 /src/PrestaShopBundle/Translation/DomainNormalizer.php
640 /classes/Media.php
641 /modules/ps_socialfollow/ps_socialfollow.php
642 /modules/ps_emailalerts/ps_emailalerts.php
643 /modules/ps_emailalerts/MailAlert.php
644 /classes/ProductDownload.php
645 /classes/tax/Tax.php
646 /src/Core/Localization/CLDR/ComputingPrecision.php
647 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
648 /src/Core/Cart/Calculator.php
649 /src/Core/Cart/CartRowCollection.php
650 /src/Core/Cart/Fees.php
651 /src/Core/Cart/AmountImmutable.php
652 /src/Core/Cart/CartRuleCollection.php
653 /src/Core/Cart/CartRuleCalculator.php
654 /src/Adapter/Product/PriceCalculator.php
655 /classes/order/Order.php
656 /src/Core/Cart/CartRow.php
657 /vendor/prestashop/decimal/src/DecimalNumber.php
658 /vendor/prestashop/decimal/src/Builder.php
659 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
660 /classes/Gender.php
661 /classes/Risk.php
662 /classes/Meta.php
663 /classes/Address.php
664 /classes/ImageType.php
665 /classes/State.php
666 /src/Core/Security/PasswordPolicyConfiguration.php
667 /src/Core/Configuration/DataConfigurationInterface.php
668 /src/Core/Filter/FrontEndObject/MainFilter.php
669 /src/Core/Filter/FilterInterface.php
670 /src/Core/Filter/FrontEndObject/CartFilter.php
671 /src/Core/Filter/HashMapWhitelistFilter.php
672 /src/Core/Filter/CollectionFilter.php
673 /src/Core/Filter/FrontEndObject/ProductFilter.php
674 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
675 /src/Core/Filter/FrontEndObject/CustomerFilter.php
676 /src/Core/Filter/FrontEndObject/ShopFilter.php
677 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
678 /modules/ps_shoppingcart/ps_shoppingcart.php
679 /modules/ets_crosssell/ets_crosssell.php
680 /modules/ets_crosssell/Ets_crosssell_db.php
681 /modules/ets_crosssell/translations/it.php
682 /classes/Manufacturer.php
683 /src/Core/Util/String/StringModifier.php
684 /src/Core/Util/String/StringModifierInterface.php
685 /modules/ps_searchbar/ps_searchbar.php
686 /modules/an_productextratabs/an_productextratabs.php
687 /modules/an_productextratabs/classes/anTabsCombinations.php
688 /modules/an_productextratabs/classes/anProductTabs.php
689 /modules/an_productextratabs/classes/anProductTabsTplContent.php
690 /modules/an_productextratabs/classes/anProductTabsLabels.php
691 /modules/an_productextratabs/translations/it.php
692 /modules/an_client_service/an_client_service.php
693 /modules/an_client_service/translations/it.php
694 /modules/an_trust_badges/an_trust_badges.php
695 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php
696 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php
697 /modules/an_trust_badges/translations/it.php
698 /modules/an_user_testimonials/an_user_testimonials.php
699 /modules/an_user_testimonials/classes/AnUserTestimonials.php
700 /modules/an_user_testimonials/translations/it.php
701 /modules/an_accordion/an_accordion.php
702 /modules/an_accordion/classes/AnAccordionBlock.php
703 /modules/an_accordion/translations/it.php
704 /modules/an_homeslider/an_homeslider.php
705 /modules/an_homeslider/classes/anHomeSliderFiles.php
706 /modules/an_homeslider/classes/anHomeSlides.php
707 /modules/an_homeslider/classes/anHomeSliders.php
708 /modules/an_homeslider/hooks_ignore.php
709 /modules/an_homeslider/translations/it.php
710 /modules/an_homeproducts/an_homeproducts.php
711 /modules/an_homeproducts/classes/anHomeProductsBlocks.php
712 /modules/an_homeproducts/classes/anHomeProductFiles.php
713 /modules/an_homeproducts/classes/anHomeProductsBanners.php
714 /modules/an_homeproducts/translations/it.php
715 /modules/an_banners/an_banners.php
716 /modules/an_banners/classes/anBanners.php
717 /modules/an_banners/hooks_ignore.php
718 /modules/an_banners/translations/it.php
719 /modules/an_simplefreeshippingline/an_simplefreeshippingline.php
720 /modules/an_simplefreeshippingline/translations/it.php
721 /modules/an_homecategories/an_homecategories.php
722 /modules/an_homecategories/classes/anHomecatFiles.php
723 /modules/an_homecategories/classes/AnHomecategories.php
724 /modules/an_homecategories/translations/it.php
725 /modules/paypal/paypal.php
726 /modules/paypal/config_prod.php
727 /classes/PaymentModule.php
728 /modules/paypal/classes/Shortcut/ShortcutConfiguration.php
729 /modules/paypal/smarty/plugins/modifier.paypalreplace.php
730 /modules/paypal/translations/it.php
731 /modules/paypal/classes/Constants/PaypalConfigurations.php
732 /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php
733 /modules/paypal/classes/Constants/WebHookConf.php
734 /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php
735 /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php
736 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php
737 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php
738 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php
739 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php
740 /modules/paypal/diagnostic.php
741 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php
742 /modules/paypal/classes/AbstractMethodPaypal.php
743 /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php
744 /modules/paypal/classes/MethodEC.php
745 /modules/paypal/classes/WhiteList/WhiteListService.php
746 /modules/paypal/classes/API/PaypalApiManager.php
747 /modules/paypal/classes/API/PaypalApiManagerInterface.php
748 /modules/paypal/classes/API/PaypalVaultApiManagerInterface.php
749 /modules/paypal/classes/API/PaypalClient.php
750 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalHttpClient.php
751 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/HttpClient.php
752 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/ProductionEnvironment.php
753 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalEnvironment.php
754 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Environment.php
755 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Encoder.php
756 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Json.php
757 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer.php
758 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Text.php
759 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Multipart.php
760 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Form.php
761 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/AuthorizationInjector.php
762 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Injector.php
763 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/GzipInjector.php
764 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/FPTIInstrumentationInjector.php
765 /classes/Smarty/SmartyCustomTemplate.php
766 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
767 /var/cache/dev/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php
768 /modules/anscrolltop/anscrolltop.php
769 /modules/anscrolltop/translations/it.php
770 /modules/darkmode/darkmode.php
771 /src/Adapter/Localization/LegacyTranslator.php
772 /modules/darkmode/translations/it.php
773 /modules/eicaptcha/eicaptcha.php
774 /modules/eicaptcha/translations/it.php
775 /modules/eicaptcha/src/Debugger.php
776 /modules/mangayo_assistant/mangayo_assistant.php
777 /modules/mangayo_assistant/translations/it.php
778 /modules/facebookproductad/facebookproductad.php
779 /modules/facebookproductad/vendor/autoload.php
780 /modules/facebookproductad/vendor/composer/autoload_real.php
781 /modules/facebookproductad/vendor/composer/platform_check.php
782 /modules/facebookproductad/vendor/composer/autoload_static.php
783 /modules/facebookproductad/translations/it.php
784 /modules/facebookproductad/lib/moduleTools.php
785 /modules/facebookproductad/conf/moduleConfiguration.php
786 /modules/facebookproductad/lib/hook/hookController.php
787 /modules/facebookproductad/lib/hook/hookDisplay.php
788 /modules/facebookproductad/lib/hook/hookBase.php
789 /modules/facebookproductad/lib/dao/moduleDao.php
790 /modules/facebookproductad/lib/pixel/basePixel.php
791 /modules/facebookproductad/lib/pixel/pixelCategory.php
792 /classes/Combination.php
793 /classes/stock/StockAvailable.php
794 /classes/SpecificPrice.php
795 /classes/tax/TaxManagerFactory.php
796 /classes/tax/TaxRulesTaxManager.php
797 /classes/tax/TaxManagerInterface.php
798 /classes/tax/TaxCalculator.php
799 /classes/GroupReduction.php
800 /classes/Pack.php
801 /classes/Feature.php
802 /var/cache/dev/smarty/compile/charme/b3/c8/1a/b3c81a5ca82982e30cc717b20aaf37611d4de76f_2.file.header.tpl.php
803 /modules/an_brandslider/an_brandslider.php
804 /modules/an_brandslider/translations/it.php
805 /modules/an_megamenu/an_megamenu.php
806 /modules/an_megamenu/classes/AnMenu.php
807 /modules/an_megamenu/classes/AnDropdown.php
808 /classes/controller/AdminController.php
809 /modules/an_megamenu/composite/AnMegaMenuConfigurator.php
810 /modules/an_megamenu/composite/AnMegaMenuMenuConfigurator.php
811 /modules/an_megamenu/composite/AnMegaMenuHooks.php
812 /modules/an_megamenu/composite/AnMegaMenuAjaxHandler.php
813 /modules/an_megamenu/composite/AnMegaMenuDropDownConfigurator.php
814 /modules/an_productattributes/an_productattributes.php
815 /modules/an_productattributes/classes/anProductAttr.php
816 /modules/an_productattributes/translations/it.php
817 /var/cache/dev/smarty/compile/charme/ed/2e/b6/ed2eb6a7d481b95124e291b11541581f4431489e_2.file.js_header.tpl.php
818 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
819 /modules/an_wishlist/an_wishlist.php
820 /modules/an_wishlist/classes/an_wish.php
821 /modules/an_wishlist/classes/an_wish_products.php
822 /modules/an_wishlist/classes/an_wishListing.php
823 /modules/an_wishlist/translations/it.php
824 /modules/an_stickyaddtocart/an_stickyaddtocart.php
825 /modules/an_stickyaddtocart/translations/it.php
826 /modules/an_theme/an_theme.php
827 /modules/an_theme/classes/InputFactory.php
828 /modules/an_theme/classes/Input.php
829 /modules/an_theme/classes/Validation.php
830 /modules/an_theme/classes/antheme.php
831 /modules/an_theme/classes/anThemeFiles.php
832 /modules/an_theme/translations/it.php
833 /themes/charme/assets/antheme/config/theme_fonts.php
834 /themes/charme/assets/antheme/config/theme_js.php
835 /themes/charme/assets/antheme/config/theme_css.php
836 /themes/charme/assets/antheme/config/vars.php
837 /themes/charme/assets/antheme/config/fields.php
838 /modules/sociallogin/sociallogin.php
839 /modules/sociallogin/translations/it.php
840 /modules/ps_googleanalytics/ps_googleanalytics.php
841 /modules/ps_googleanalytics/vendor/autoload.php
842 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
843 /modules/ps_googleanalytics/vendor/composer/platform_check.php
844 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
845 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
846 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
847 /var/cache/dev/smarty/compile/charme/d2/a4/03/d2a40332993e3600f818db0d45a227f1af331e1a_2.file.ps_googleanalytics.tpl.php
848 /modules/luminage_mail/luminage_mail.php
849 /modules/luminage_mail/translations/it.php
850 /modules/hioutofstocknotification/hioutofstocknotification.php
851 /modules/hioutofstocknotification/classes/HiPrestaModule.php
852 /modules/hioutofstocknotification/classes/outofstock.php
853 /modules/hioutofstocknotification/classes/sentemail.php
854 /modules/hioutofstocknotification/classes/statistic.php
855 /modules/hioutofstocknotification/classes/oosnpdf.php
856 /classes/pdf/HTMLTemplate.php
857 /modules/hioutofstocknotification/classes/adminForms.php
858 /modules/hioutofstocknotification/translations/it.php
859 /var/cache/dev/smarty/compile/charme/b2/c3/47/b2c3472b487ed27b1e317c435a1d8b7f737453cb_2.file.header.tpl.php
860 /modules/ambjolisearch/ambjolisearch.php
861 /modules/ambjolisearch/classes/AmbJolisearchModule.php
862 /modules/ambjolisearch/classes/AmbIndexation.php
863 /modules/ambjolisearch/classes/AmbSearch.php
864 /modules/ambjolisearch/classes/definitions.php
865 /modules/ambjolisearch/classes/JoliLink.php
866 /modules/ambjolisearch/classes/JoliLink-1.7.php
867 /modules/ambjolisearch/classes/AmbJolisearchModuleProxy.php
868 /modules/ambjolisearch/translations/it.php
869 /modules/hicookielaw/hicookielaw.php
870 /modules/hicookielaw/classes/HiPrestaModule.php
871 /modules/hicookielaw/classes/adminForms.php
872 /modules/hicookielaw/classes/consent.php
873 /modules/hicookielaw/classes/type.php
874 /modules/hicookielaw/translations/it.php
875 /var/cache/dev/smarty/compile/charme/0c/8b/7b/0c8b7bc449184adb2e93a99131724c331ff4e737_2.file.header.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
877 /modules/payplug/payplug.php
878 /modules/payplug/translations/it.php
879 /modules/payplug/classes/PayPlugDependencies.php
880 /modules/payplug/classes/DependenciesClass.php
881 /modules/payplug/src/utilities/validators/accountValidator.php
882 /modules/payplug/src/utilities/validators/browserValidator.php
883 /modules/payplug/src/utilities/validators/cardValidator.php
884 /modules/payplug/src/utilities/validators/lockValidator.php
885 /modules/payplug/src/utilities/validators/loggerValidator.php
886 /modules/payplug/src/utilities/validators/moduleValidator.php
887 /modules/payplug/src/utilities/validators/orderValidator.php
888 /modules/payplug/src/utilities/validators/paymentValidator.php
889 /modules/payplug/src/utilities/helpers/AmountHelper.php
890 /modules/payplug/src/utilities/helpers/CookiesHelper.php
891 /modules/payplug/src/utilities/helpers/FilesHelper.php
892 /modules/payplug/src/utilities/helpers/PhoneHelper.php
893 /modules/payplug/src/utilities/helpers/UserHelper.php
894 /modules/payplug/src/application/dependencies/PluginInit.php
895 /modules/payplug/src/application/dependencies/BaseClass.php
896 /modules/payplug/src/actions/CardAction.php
897 /modules/payplug/src/actions/ConfigurationAction.php
898 /modules/payplug/src/actions/MerchantTelemetryAction.php
899 /modules/payplug/src/actions/OnboardingAction.php
900 /modules/payplug/src/actions/OrderStateAction.php
901 /modules/payplug/src/actions/PaymentAction.php
902 /modules/payplug/src/models/entities/CacheEntity.php
903 /modules/payplug/src/models/entities/OneyEntity.php
904 /modules/payplug/src/models/entities/PluginEntity.php
905 /modules/payplug/src/models/entities/OrderStateEntity.php
906 /modules/payplug/src/application/adapter/AddressAdapter.php
907 /modules/payplug/src/interfaces/AddressInterface.php
908 /modules/payplug/src/application/adapter/AssignAdapter.php
909 /modules/payplug/src/interfaces/AssignInterface.php
910 /modules/payplug/src/application/adapter/CarrierAdapter.php
911 /modules/payplug/src/interfaces/CarrierInterface.php
912 /classes/Carrier.php
913 /modules/payplug/src/application/adapter/CartAdapter.php
914 /modules/payplug/src/interfaces/CartInterface.php
915 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
916 /modules/payplug/src/interfaces/ConfigurationInterface.php
917 /modules/payplug/src/application/adapter/ConstantAdapter.php
918 /modules/payplug/src/interfaces/ConstantInterface.php
919 /modules/payplug/src/application/adapter/ContextAdapter.php
920 /modules/payplug/src/interfaces/ContextInterface.php
921 /modules/payplug/src/application/adapter/CountryAdapter.php
922 /modules/payplug/src/interfaces/CountryInterface.php
923 /modules/payplug/src/application/adapter/CurrencyAdapter.php
924 /modules/payplug/src/interfaces/CurrencyInterface.php
925 /modules/payplug/src/application/adapter/CustomerAdapter.php
926 /modules/payplug/src/interfaces/CustomerInterface.php
927 /modules/payplug/src/application/adapter/DispatcherAdapter.php
928 /modules/payplug/src/interfaces/DispatcherInterface.php
929 /modules/payplug/src/application/adapter/LanguageAdapter.php
930 /modules/payplug/src/interfaces/LanguageInterface.php
931 /modules/payplug/src/application/adapter/MediaAdapter.php
932 /modules/payplug/src/interfaces/MediaInterface.php
933 /modules/payplug/src/application/adapter/MessageAdapter.php
934 /modules/payplug/src/interfaces/MessageInterface.php
935 /modules/payplug/src/application/adapter/ModuleAdapter.php
936 /modules/payplug/src/interfaces/ModuleInterface.php
937 /modules/payplug/src/application/adapter/OrderAdapter.php
938 /modules/payplug/src/interfaces/OrderInterface.php
939 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
940 /modules/payplug/src/interfaces/OrderHistoryInterface.php
941 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
942 /modules/payplug/src/interfaces/OrderSlipInterface.php
943 /modules/payplug/src/application/adapter/OrderStateAdapter.php
944 /modules/payplug/src/interfaces/OrderStateInterface.php
945 /classes/order/OrderState.php
946 /modules/payplug/src/application/adapter/ProductAdapter.php
947 /modules/payplug/src/interfaces/ProductInterface.php
948 /modules/payplug/src/application/adapter/QueryAdapter.php
949 /modules/payplug/src/interfaces/QueryInterface.php
950 /modules/payplug/src/application/adapter/ShopAdapter.php
951 /modules/payplug/src/interfaces/ShopInterface.php
952 /modules/payplug/src/application/adapter/ToolsAdapter.php
953 /modules/payplug/src/interfaces/ToolsInterface.php
954 /modules/payplug/src/application/adapter/TranslationAdapter.php
955 /modules/payplug/src/interfaces/TranslationInterface.php
956 /modules/payplug/src/application/adapter/ValidateAdapter.php
957 /modules/payplug/src/interfaces/ValidateInterface.php
958 /modules/payplug/src/models/classes/ApiRest.php
959 /modules/payplug/src/models/classes/Configuration.php
960 /modules/payplug/src/models/classes/Country.php
961 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
962 /modules/payplug/src/models/classes/Translation.php
963 /modules/payplug/translations/en.php
964 /modules/payplug/src/models/repositories/CardRepository.php
965 /modules/payplug/src/models/repositories/QueryRepository.php
966 /modules/payplug/src/models/repositories/CacheRepository.php
967 /modules/payplug/src/models/repositories/CountryRepository.php
968 /modules/payplug/src/models/repositories/LockRepository.php
969 /modules/payplug/src/models/repositories/LoggerRepository.php
970 /modules/payplug/src/models/repositories/ModuleRepository.php
971 /modules/payplug/src/models/repositories/OrderRepository.php
972 /modules/payplug/src/models/repositories/OrderStateRepository.php
973 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
974 /modules/payplug/src/models/repositories/PaymentRepository.php
975 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
976 /modules/payplug/src/models/repositories/ShopRepository.php
977 /modules/payplug/classes/MyLogPHP.php
978 /modules/payplug/src/repositories/LoggerRepository.php
979 /modules/payplug/src/models/entities/LoggerEntity.php
980 /modules/payplug/src/repositories/TranslationsRepository.php
981 /modules/payplug/src/repositories/SQLtableRepository.php
982 /modules/payplug/src/repositories/CacheRepository.php
983 /modules/payplug/src/repositories/OneyRepository.php
984 /modules/payplug/src/repositories/OrderStateRepository.php
985 /modules/payplug/src/repositories/InstallRepository.php
986 /modules/payplug/src/utilities/services/Browser.php
987 /modules/payplug/src/utilities/services/Routes.php
988 /modules/payplug/src/utilities/services/MerchantTelemetry.php
989 /modules/payplug/classes/ApiClass.php
990 /modules/payplug/classes/ApplePayClass.php
991 /modules/payplug/classes/AmountCurrencyClass.php
992 /modules/payplug/classes/AdminClass.php
993 /modules/payplug/classes/PayplugLock.php
994 /modules/payplug/classes/CartClass.php
995 /modules/payplug/classes/ConfigClass.php
996 /modules/payplug/classes/InstallmentClass.php
997 /modules/payplug/classes/HookClass.php
998 /modules/payplug/classes/MediaClass.php
999 /modules/payplug/classes/OrderClass.php
1000 /modules/payplug/classes/PaymentClass.php
1001 /modules/payplug/classes/RefundClass.php
1002 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1003 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1004 /var/cache/dev/smarty/compile/charme/6a/fd/5e/6afd5effcf983f0813cac21afbfc06523d64a8ee_2.file.messages.tpl.php
1005 /modules/app_endpoint/app_endpoint.php
1006 /modules/app_endpoint/translations/it.php
1007 /modules/codwfeeplus/codwfeeplus.php
1008 /modules/codwfeeplus/CODwFP.php
1009 /modules/codwfeeplus/translations/it.php
1010 /src/Core/Product/Search/ProductSearchContext.php
1011 /src/Core/Product/Search/ProductSearchQuery.php
1012 /src/Core/Product/Search/SortOrder.php
1013 /modules/ps_facetedsearch/ps_facetedsearch.php
1014 /modules/ps_facetedsearch/src/HookDispatcher.php
1015 /modules/ps_facetedsearch/src/Hook/Attribute.php
1016 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1017 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1018 /modules/ps_facetedsearch/src/Hook/Category.php
1019 /modules/ps_facetedsearch/src/Hook/Configuration.php
1020 /modules/ps_facetedsearch/src/Hook/Design.php
1021 /modules/ps_facetedsearch/src/Hook/Feature.php
1022 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1023 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1024 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1025 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1026 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1027 /modules/ps_facetedsearch/src/Hook/Product.php
1028 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1029 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1030 /modules/ps_facetedsearch/src/Filters/Provider.php
1031 /modules/ps_facetedsearch/src/URLSerializer.php
1032 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1033 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1034 /src/Core/Product/Search/FacetsRendererInterface.php
1035 /src/Core/Product/Search/ProductSearchProviderInterface.php
1036 /modules/ps_facetedsearch/src/Filters/Converter.php
1037 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1038 /modules/ambjolisearch/src/Amb_ProductSearchProvider.php
1039 /src/Core/Product/Search/ProductSearchResult.php
1040 /modules/ps_facetedsearch/src/Product/Search.php
1041 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1042 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1043 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1044 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1045 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1046 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1047 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1048 /modules/ps_facetedsearch/src/Filters/Products.php
1049 /modules/ps_facetedsearch/src/Filters/Block.php
1050 /src/Core/Product/Search/Facet.php
1051 /src/Core/Product/Search/Filter.php
1052 /src/Core/Product/Search/FacetCollection.php
1053 /classes/ProductAssembler.php
1054 /classes/ProductPresenterFactory.php
1055 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1056 /src/Adapter/Presenter/Product/ProductPresenter.php
1057 /src/Adapter/Product/ProductColorsRetriever.php
1058 /src/Adapter/HookManager.php
1059 /src/Core/Product/ProductPresentationSettings.php
1060 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1061 /src/Adapter/Presenter/Product/ProductLazyArray.php
1062 /src/Adapter/Presenter/AbstractLazyArray.php
1063 /classes/Image.php
1064 /src/Core/Image/ImageFormatConfiguration.php
1065 /src/Core/Image/ImageFormatConfigurationInterface.php
1066 /classes/FeatureFlag.php
1067 /src/Core/FeatureFlag/FeatureFlagSettings.php
1068 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1069 /vendor/prestashop/decimal/src/Operation/Addition.php
1070 /src/Core/Util/Inflector.php
1071 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1072 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1073 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1074 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1075 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1076 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1077 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1078 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1079 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1080 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1081 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1082 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1083 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1084 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1085 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1086 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1087 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1088 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1089 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1090 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1091 /var/cache/dev/smarty/compile/charme/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1093 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1094 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1095 /var/cache/dev/smarty/compile/charme/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1096 /src/Core/Product/Search/Pagination.php
1097 /modules/sociallogin/models/SocialLoginPosition.php
1098 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/66/81/f1/6681f1287ad4751f4330999bf7e5047ef3e52cec_2.file.category.tpl.php
1099 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ee/8c/21/ee8c21f25c301be5b9dae26ba3672f4427c6aeb2_2.file.product-list.tpl.php
1100 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/c1/e5/02/c1e502525a49748091427e0df780f90846bd9d90_2.file.layout-left-column.tpl.php
1101 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a2/43/0d/a2430dfc6da9bb5b779a9919d46af9cb98017def_2.file.layout-both-columns.tpl.php
1102 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a0/b9/f1/a0b9f11bc34eb90e03108a3780da705e4c424c76_2.file.head.tpl.php
1103 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5c/99/24/5c9924d502b61764c40eeba7cd7dda269692307d_2.file.stylesheets.tpl.php
1104 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/3b/3c/ff/3b3cff40db7c22a4ee30c69b5f51819b85be6d9c_2.file.preload.tpl.php
1105 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ad/54/e6/ad54e66984a22371c20ef3cde2b3e98bd215d8e8_2.file.javascript.tpl.php
1106 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/fd/59/0a/fd590a6b567acb629cd24ef142a6acc3994b20dd_2.file.product-activation.tpl.php
1107 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/6b/40/6a/6b406af67655c04b1b8bc34738282cebbf0034fb_2.file.header.tpl.php
1108 /var/cache/dev/smarty/compile/charme/ba/f0/71/baf0714d120e11446c0237301b6cccbc40531653_2.module.an_simplefreeshippinglineviewstemplatesfrontwidget.tpl.php
1109 /modules/ps_languageselector/ps_languageselector.php
1110 /modules/ps_currencyselector/ps_currencyselector.php
1111 /var/cache/dev/smarty/compile/charme/49/36/e5/4936e564782a528c3079f559922e796453f1af1a_2.module.an_client_serviceviewstemplatesfrontwidget.tpl.php
1112 /modules/darkmode/src/Model/DarkModeOptionsModel.php
1113 /modules/darkmode/src/Db/QueryBuilder.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_clearcache.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1116 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1117 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_cacheresourcefile.php
1118 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1120 /var/cache/dev/smarty/compile/charme/a3/cf/9f/a3cf9f8dbcef1e72a52283b913857be8db6a8b80_2.module.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.cache.php
1121 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1122 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1123 /var/cache/dev/smarty/cache/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php
1124 /modules/ps_customersignin/ps_customersignin.php
1125 /var/cache/dev/smarty/compile/charme/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1126 /var/cache/dev/smarty/compile/charme/62/b3/ea/62b3ea25f9be6f347bb81fe6309b35116e17553f_2.module.an_wishlistviewstemplatesfrontnav.tpl.php
1127 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1128 /var/cache/dev/smarty/compile/charme/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1129 /modules/an_logo/an_logo.php
1130 /modules/an_logo/translations/it.php
1131 /var/cache/dev/smarty/compile/charme/74/96/d2/7496d2b81ba6ced33a36c630e03cb86d3b647a4b_2.module.an_logoviewstemplatesfrontlogo.tpl.php
1132 /var/cache/dev/smarty/compile/charme/bd/eb/23/bdeb239cddb118da7e29251e756fe96cb3dbe26b_2.file.an_megamenu.tpl.cache.php
1133 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php
1134 /var/cache/dev/smarty/compile/charme/11/0e/c7/110ec72aa9921d2c382ad628bdb2f0bc5105a617_2.module.ps_searchbarps_searchbar.tpl.php
1135 /var/cache/dev/smarty/compile/charme/6a/4b/17/6a4b178cc6ac5016a51cc4db2dda74b30a8cd612_2.file.an_megamenu_mobile.tpl.cache.php
1136 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php
1137 /modules/paypal/classes/InstallmentBanner/BannerManager.php
1138 /modules/paypal/classes/InstallmentBanner/Banner.php
1139 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/b6/b4/37/b6b437561c01fc88997451a413028764044621b6_2.file.notifications.tpl.php
1140 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5b/7f/12/5b7f12aebdf137ed79e78dddcd112712d43e20b5_2.file.breadcrumb.tpl.php
1141 /modules/ps_categorytree/ps_categorytree.php
1142 /var/cache/dev/smarty/compile/charme/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1143 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1144 /var/cache/dev/smarty/compile/charme/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1145 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/22/46/68/2246682b55d5939ba2438c9cba4d4cef07b7d99c_2.file.products-top.tpl.php
1146 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/e7/d5/5d/e7d55de2607b7a3747d835209dfa0bf329274823_2.file.sort-orders.tpl.php
1147 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/cc/2a/92/cc2a920e103307f38418741dbd6eeb78d4f4244b_2.file.products.tpl.php
1148 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/64/de/36/64de36afa8ae49504410858f9ee0be9233599a2b_2.file.product.tpl.php
1149 /var/cache/dev/smarty/compile/charme/62/77/7b/62777bbf995f423da45bdc9d94b3b2255e0685b7_2.module.an_wishlistviewstemplatesfrontproductminiature.tpl.php
1150 /var/cache/dev/smarty/compile/charme/b8/c2/d3/b8c2d37a7784d2c0bb28c4512a21f9b34473d1ad_2.file.productattributes.tpl.php
1151 /var/cache/dev/smarty/compile/charme/c2/f6/38/c2f6388ad4d70d04993a1b28e28ed73fbe5270a8_2.module.an_productattributesviewstemplatesfrontproductattributeswrapper.tpl.php
1152 /var/cache/dev/smarty/compile/charme/50/e3/6e/50e36e4f3c2a4795be15b313ca9e72dc460a5959_2.file.product-variants.tpl.php
1153 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a9/33/f4/a933f46e6d0f30297d17cc3e63762fa9de0d686c_2.file.pagination.tpl.php
1154 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/03/b6/70/03b67016d311f010e0c867f508f78946bb5f1315_2.file.products-bottom.tpl.php
1155 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/38/2a/57/382a577075ddb0537c28ca99407fca0d658514ed_2.file.footer.tpl.php
1156 /modules/ps_contactinfo/ps_contactinfo.php
1157 /var/cache/dev/smarty/compile/charme/99/92/f3/9992f3fe04dd41bcec1a2029cf07bead637caf4d_2.module.ps_contactinfops_contactinfo.tpl.php
1158 /modules/ps_linklist/ps_linklist.php
1159 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php
1160 /modules/ps_linklist/src/Filter/LinkFilter.php
1161 /modules/ps_linklist/src/Filter/BestSalesRouteFilter.php
1162 /modules/ps_linklist/src/Filter/RouteFilterInterface.php
1163 /modules/ps_linklist/src/LegacyLinkBlockRepository.php
1164 /modules/ps_linklist/src/Model/LinkBlock.php
1165 /classes/CMS.php
1166 /var/cache/dev/smarty/compile/charme/90/65/48/906548e89c8c6025457ddaeffb1980a0c743b872_2.module.ps_linklistviewstemplateshooklinkblock.tpl.cache.php
1167 /var/cache/dev/smarty/cache/ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php
1168 /var/cache/dev/smarty/compile/charme/94/04/dd/9404dddf9d62e01629bc90a9cb65c9dd834a2134_2.module.darkmodeviewstemplatesfrontdarkmode_functions.tpl.cache.php
1169 /var/cache/dev/smarty/cache/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php
1170 /modules/ps_customeraccountlinks/ps_customeraccountlinks.php
1171 /var/cache/dev/smarty/compile/charme/42/f9/46/42f9461127ce7396a601c2484841253ea5ba658f_2.module.ps_customeraccountlinksps_customeraccountlinks.tpl.cache.php
1172 /var/cache/dev/smarty/cache/ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php
1173 /var/cache/dev/smarty/compile/charme/b7/0c/56/b70c564919bbf154e7811f43c0a130bb3dc49f9f_2.file.display_footer.tpl.php
1174 /modules/an_copyright/an_copyright.php
1175 /modules/an_copyright/translations/it.php
1176 /var/cache/dev/smarty/compile/charme/56/a5/c8/56a5c82cce1796d8dbfa7b0b327052e3fece4682_2.module.an_copyrightviewstemplatesfrontwidget.tpl.php
1177 /var/cache/dev/smarty/compile/charme/31/32/2b/31322b94623342814b8c7d4182cfda837762840e_2.module.an_trust_badgesviewstemplatesfrontwidget.tpl.php
1178 /modules/statsdata/statsdata.php
1179 /classes/Connection.php
1180 /classes/Page.php
1181 /classes/ConnectionsSource.php
1182 /classes/DateRange.php
1183 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1184 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1185 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1186 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1187 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1188 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1189 /var/cache/dev/smarty/compile/charme/9b/b4/49/9bb449ecf8392afc0ebd444efd0e58f7f03bd397_2.file.ga_tag.tpl.php