Manga

Manga

Tutti i manga sono protetti in una perfetta bustina protettiva su misura.

Filtri attivi

  • Categoria : Manhwa
  • Categoria : Novel
  • Categoria : Seinen
  • Genere: Erotico
  • Genere: Thriller

Black Joke 10

4,72 € 5,90 €

Black Joke Volume: 10 Storia: Rintarō Koike Disegni: Masayuki Taguchi Editore: JPOP Lingua: Italiano

Monster Deluxe 3

13,21 € 13,90 €

Monster Deluxe Volume: 3 Storia: Naoki Urasawa Disegni: Naoki Urasawa Formato: 14.5x21 Editore: Planet Manga Lingua: Italiano

Monster Deluxe 4

13,21 € 13,90 €

Monster Deluxe Volume: 4 Storia: Naoki Urasawa Disegni: Naoki Urasawa Formato: 14.5x21 Editore: Planet Manga Lingua: Italiano

Peep Hole 9

6,00 € 7,50 €

Peep Hole Volume: 9 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

Peep Hole 10

6,00 € 7,50 €

Peep Hole Volume: 10 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

Peep Hole 11

6,00 € 7,50 €

Peep Hole Volume: 11 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

Peep Hole 12

6,00 € 7,50 €

Peep Hole Volume: 12 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

Peep Hole 13

6,00 € 7,50 €

Peep Hole Volume: 13 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

Peep Hole 6

6,00 € 7,50 €

Peep Hole Volume: 6 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

Peep Hole 7

6,00 € 7,50 €

Peep Hole Volume: 7 Storia: Wakoh Honna Disegni: Wakoh Honna Editore: JPOP Lingua: Italiano

20th Century Boys 6

6,65 € 7,00 €

20th Century Boys  Volume: 6 Storia: Naoki Urasawa Disegni: Naoki Urasawa Formato: 13x18 Editore: Panini Comics Lingua: Italiano

Monster Deluxe 6

13,21 € 13,90 €

5Monster Deluxe Volume: 6 Storia: Naoki Urasawa Disegni: Naoki Urasawa Formato: 14.5x21 Editore: Planet Manga Lingua: Italiano

Monster Deluxe 8

13,21 € 13,90 €

5Monster Deluxe Volume: 8 Storia: Naoki Urasawa Disegni: Naoki Urasawa Formato: 14.5x21 Editore: Planet Manga Lingua: Italiano

Monster Deluxe 9

13,21 € 13,90 €

5Monster Deluxe Volume: 9 Storia: Naoki Urasawa Disegni: Naoki Urasawa Formato: 14.5x21 Editore: Planet Manga Lingua: Italiano

Messe a nudo 5

7,51 € 7,90 €

Messe a nudo Volume: 5 Storia: LINDA Disegni: LINDA Editore: Magic Press Lingua: Italiano

Messe a nudo 1

7,51 € 7,90 €

Messe a nudo Volume: 1 Storia: LINDA Disegni: LINDA Editore: Magic Press Lingua: Italiano

Messe a nudo 2

7,51 € 7,90 €

Messe a nudo Volume: 2 Storia: LINDA Disegni: LINDA Editore: Magic Press Lingua: Italiano

Messe a nudo 3

7,51 € 7,90 €

Messe a nudo Volume: 3 Storia: LINDA Disegni: LINDA Editore: Magic Press Lingua: Italiano

Messe a nudo 4

7,51 € 7,90 €

Messe a nudo Volume: 4 Storia: LINDA Disegni: LINDA Editore: Magic Press Lingua: Italiano

Another Monster

15,20 € 16,00 €

Another Monster Volume: Unico Storia: Takashi Nagasaki, Werner Weber Disegni: Naoki Urasawa, Werner Weber Editore: Panini Comics Lingua: Italiano

Trese 1

8,46 € 8,90 €

Trese  Volume: 1 Storia: Budjette Tan Disegni: Kajo Baldisimo Formato: 14.5x21 Editore: Star Comics Lingua: Italiano

Kamasutra manga

11,40 € 12,00 €

Kamasutra Volume: Unico Storia: Vatsyayana Disegni: Variety Art Works Editore: 001 Edizioni Lingua: Italiano

Bastardo 2

11,88 € 12,50 €

Bastardo Volume: 2 Storia: Carnby Kim Disegni: Young Chan Hwang Editore: RW Goen Lingua: Italiano

Rasputin il patriota 1

14,25 € 15,00 €

Rasputin il patriota Volumi: 1 Storia: Takashi Nagasaki Disegni: Junji Itō Formato: 15x21 Editore: Star Comics Lingua: Italiano

Load Time 1236 ms
Querying Time 1095 ms
Queries 1134
Memory Peak Usage 30.7 Mb
Included Files 1190 files - 12.41 Mb
PrestaShop Cache - Mb
Global vars 0.37 Mb
PrestaShop Version 8.1.2
PHP Version 8.1.27
MySQL Version 10.5.11-MariaDB-1:10.5.11+maria~buster-log
Memory Limit 512M
Max Execution Time 60s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 2.118 ms 2.118 ms 2.88 Mb 3.2 Mb
__construct 0.009 ms 2.127 ms - Mb 3.2 Mb
init 12.238 ms 14.365 ms 0.50 Mb 3.5 Mb
checkAccess 0.002 ms 14.367 ms - Mb 3.5 Mb
setMedia 2.332 ms 16.699 ms 0.10 Mb 3.5 Mb
postProcess 0.001 ms 16.700 ms - Mb 3.5 Mb
initHeader 0.001 ms 16.701 ms - Mb 3.5 Mb
initContent 927 ms 944 ms 11.54 Mb 15.1 Mb
initFooter 0.002 ms 944 ms - Mb 15.1 Mb
display 292.127 ms 1236 ms 14.99 Mb 30.7 Mb
Hook Time Memory Usage
DisplayHeader 228.963 ms 4.89 Mb
DisplayProductPriceBlock 99.761 ms 6.22 Mb
displayFooter 42.628 ms 1.39 Mb
displayProductListReviews 24.254 ms 1.71 Mb
ActionProductFlagsModifier 22.979 ms 1.76 Mb
displayNav2 13.713 ms 0.41 Mb
DisplayBeforeBodyClosingTag 12.923 ms 0.32 Mb
Header 12.572 ms 0.37 Mb
DisplayFooter 10.996 ms 0.07 Mb
DisplayTop 10.187 ms 0.37 Mb
DisplayMobileMenu 9.855 ms 0.38 Mb
displayNav1 1.956 ms 0.11 Mb
displayLeftColumn 1.863 ms 0.06 Mb
displayCopyrightContainer 1.851 ms 0.09 Mb
displayNavFullWidth 1.179 ms 0.08 Mb
DisplayOverrideTemplate 1.138 ms 0.03 Mb
displayTopLeft 0.916 ms 0.04 Mb
displayCopyrightContainerLeft 0.916 ms 0.06 Mb
displayClientService 0.873 ms 0.06 Mb
displayBanner 0.840 ms 0.04 Mb
DisplayNavFullWidth 0.557 ms 0.03 Mb
ActionFrontControllerSetMedia 0.192 ms 0.01 Mb
displayTopRight 0.169 ms - Mb
displayFooterLogo 0.125 ms - Mb
DisplayLeftColumn 0.096 ms 0.06 Mb
ProductSearchProvider 0.095 ms - Mb
ModuleRoutes 0.007 ms - Mb
27 hook(s) 501.604 ms 18.56 Mb
Module Time Memory Usage
anblog 1.850 ms 0.02 Mb
ps_emailsubscription 1.248 ms 0.08 Mb
ps_socialfollow 0.075 ms 0.01 Mb
ps_emailalerts 0.111 ms 0.01 Mb
ps_shoppingcart 1.116 ms 0.06 Mb
ets_crosssell 29.729 ms 0.18 Mb
ps_searchbar 0.316 ms 0.01 Mb
an_productextratabs 23.107 ms 1.78 Mb
an_client_service 0.963 ms 0.07 Mb
an_trust_badges 1.936 ms 0.09 Mb
an_user_testimonials 0.140 ms 0.01 Mb
an_accordion 0.100 ms 0.01 Mb
an_homeslider 0.149 ms 0.01 Mb
an_homeproducts 0.163 ms 0.01 Mb
an_banners 0.096 ms 0.01 Mb
an_simplefreeshippingline 0.929 ms 0.05 Mb
an_homecategories 0.099 ms 0.07 Mb
paypal 2.112 ms 0.17 Mb
anscrolltop 0.226 ms 0.06 Mb
darkmode 20.282 ms 0.36 Mb
eicaptcha 0.111 ms - Mb
mangayo_assistant 0.112 ms 0.01 Mb
facebookproductad 197.483 ms 4.63 Mb
an_brandslider 11.323 ms 0.14 Mb
an_megamenu 20.388 ms 0.81 Mb
an_productattributes 99.159 ms 6.13 Mb
an_wishlist 25.822 ms 1.81 Mb
an_stickyaddtocart 0.087 ms 0.01 Mb
an_theme 1.212 ms 0.10 Mb
sociallogin 4.478 ms 0.14 Mb
ps_googleanalytics 2.675 ms 0.12 Mb
luminage_mail 0.124 ms 0.01 Mb
hioutofstocknotification 0.440 ms 0.03 Mb
ambjolisearch 10.031 ms 0.26 Mb
hicookielaw 1.378 ms 0.04 Mb
payplug 4.983 ms 0.44 Mb
app_endpoint 0.118 ms 0.01 Mb
codwfeeplus 2.304 ms 0.15 Mb
ps_facetedsearch 0.361 ms 0.11 Mb
ps_languageselector 0.810 ms 0.05 Mb
ps_currencyselector 1.262 ms 0.07 Mb
ps_customersignin 1.116 ms 0.07 Mb
an_logo 1.199 ms 0.05 Mb
ps_categorytree 1.934 ms 0.09 Mb
ps_contactinfo 1.687 ms 0.09 Mb
ps_linklist 27.133 ms 1.02 Mb
ps_customeraccountlinks 4.206 ms 0.18 Mb
an_copyright 1.013 ms 0.06 Mb
statsdata 10.501 ms 0.22 Mb
49 module(s) 518.196 ms 19.89 Mb

Stopwatch SQL - 1134 queries

# Query Time (ms) Rows Filesort Group By Location
389
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=4)) AND ((fp_1.id_feature_value IN (41, 76, 14))) GROUP BY fp.id_feature_value
116.622 ms 4832343040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
385
SELECT SQL_NO_CACHE p.id_product, sa.out_of_stock FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY IFNULL(p.quantity, 0) <= 0, IFNULL(p.quantity, 0) <= 0 AND FIELD(sa.out_of_stock, 1) DESC, p.position ASC, p.id_product DESC LIMIT 0, 24
112.515 ms 10062341603328 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
387
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (67, 63))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=3)) AND ((fp_1.id_feature_value IN (67, 63))) GROUP BY fp.id_feature_value
92.800 ms 592596480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
386
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63)))
83.856 ms 711115776 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
394
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM mangayo_product p INNER JOIN mangayo_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28
65.237 ms 4672 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
393
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63))) AND cg.id_group='1' AND c.nleft>11 AND c.nright<28 GROUP BY cp.id_category
8.936 ms 1831424 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `mangayo_configuration` c
LEFT JOIN `mangayo_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
8.674 ms 2039 /classes/Configuration.php:180
1130
SELECT SQL_NO_CACHE `id_date_range`, `time_end`
FROM `mangayo_date_range`
WHERE `time_end` = (SELECT MAX(`time_end`) FROM `mangayo_date_range`) LIMIT 1
6.809 ms 91431844 /classes/DateRange.php:60
1108
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
5.635 ms 1 /classes/Smarty/SmartyCustom.php:280
729
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
5.197 ms 1 /classes/Smarty/SmartyCustom.php:280
79
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `mangayo_hook_module` hm
STRAIGHT_JOIN `mangayo_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `mangayo_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
3.934 ms 610 /classes/Hook.php:456
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `mangayo_module` m
INNER JOIN mangayo_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `mangayo_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `mangayo_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `mangayo_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.655 ms 182 Yes Yes /classes/Hook.php:1233
78
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `mangayo_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `mangayo_hook_alias` ha
INNER JOIN `mangayo_hook` h ON ha.name = h.name
3.216 ms 0 /classes/Hook.php:1292
65
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-06-28 00:00:00",
INTERVAL 10 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `mangayo_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `mangayo_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `mangayo_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `mangayo_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `mangayo_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 11 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
3.077 ms 11258 /classes/Category.php:1059
321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
2.532 ms 1 /classes/SpecificPrice.php:259
391
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM mangayo_product p LEFT JOIN mangayo_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN mangayo_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN mangayo_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN mangayo_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN mangayo_category_product cp ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN mangayo_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN mangayo_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (41, 76, 14))) AND ((fp_1.id_feature_value IN (67, 63))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=11 AND c.nright<=28 GROUP BY p.id_product) p INNER JOIN mangayo_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN mangayo_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN mangayo_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=5)) AND ((fp_1.id_feature_value IN (41, 76, 14))) AND ((fp_2.id_feature_value IN (67, 63))) GROUP BY fp.id_feature_value
2.337 ms 1792 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
320
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 306) AND (b.`id_shop` = 1) LIMIT 1
1.844 ms 1 /src/Adapter/EntityMapper.php:71
347
SHOW TABLES LIKE "%mangayo_social_login_%"
1.813 ms 1 /modules/sociallogin/sociallogin.php:186
40
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
1.564 ms 178 /classes/CartRule.php:418
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `mangayo_hook` h
WHERE (h.active = 1)
1.483 ms 986 /classes/Hook.php:1332
1133
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `mangayo_category_product` cp
LEFT JOIN `mangayo_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `mangayo_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (10559,1284,1285,8385,8386,8387,8388,8389,8382,8383,1426,2346,2348,2349,3214,3369,3370,3371,3372,3423,3669,4207,4632,4781) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
1.460 ms 64 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
395
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-06-28 00:00:00',
INTERVAL 10 DAY
)
) > 0) as new
FROM mangayo_product p
LEFT JOIN mangayo_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN mangayo_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN mangayo_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (10559,1284,1285,8385,8386,8387,8388,8389,8382,8383,1426,2346,2348,2349,3214,3369,3370,3371,3372,3423,3669,4207,4632,4781)
1.388 ms 24 /classes/ProductAssembler.php:95
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `mangayo_hook`
1.338 ms 986 /classes/Hook.php:1292
58
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
1.328 ms 40 Yes /classes/Manufacturer.php:211
33
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `mangayo_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 11
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.309 ms 7 Yes Yes /classes/Category.php:921
984
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3370
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.255 ms 2 Yes Yes /classes/Product.php:4578
876
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8389
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.239 ms 2 Yes Yes /classes/Product.php:4578
1095
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 8 AND `id_shop` = 1
1.218 ms 1 /src/Adapter/EntityMapper.php:79
1089
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 3 AND `id_shop` = 1
1.211 ms 1 /src/Adapter/EntityMapper.php:79
912
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1426
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.202 ms 2 Yes Yes /classes/Product.php:4578
792
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 10559
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.201 ms 2 Yes Yes /classes/Product.php:4578
948
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 2349
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.185 ms 2 Yes Yes /classes/Product.php:4578
311
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 305) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.164 ms 2 Yes /classes/SpecificPrice.php:576
245
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 299) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.160 ms 2 Yes /classes/SpecificPrice.php:576
936
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 2348
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.159 ms 2 Yes Yes /classes/Product.php:4578
972
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3369
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.159 ms 2 Yes Yes /classes/Product.php:4578
1044
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4207
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.148 ms 2 Yes Yes /classes/Product.php:4578
924
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 2346
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.143 ms 2 Yes Yes /classes/Product.php:4578
852
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8387
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.142 ms 2 Yes Yes /classes/Product.php:4578
900
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8383
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.142 ms 2 Yes Yes /classes/Product.php:4578
996
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3371
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.142 ms 2 Yes Yes /classes/Product.php:4578
1008
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3372
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.128 ms 2 Yes Yes /classes/Product.php:4578
804
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1284
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.121 ms 2 Yes Yes /classes/Product.php:4578
1020
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3423
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.121 ms 2 Yes Yes /classes/Product.php:4578
840
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8386
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.119 ms 2 Yes Yes /classes/Product.php:4578
91
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 285) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.119 ms 2 Yes /classes/SpecificPrice.php:576
1032
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3669
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.114 ms 2 Yes Yes /classes/Product.php:4578
828
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8385
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.114 ms 2 Yes Yes /classes/Product.php:4578
1068
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4781
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.108 ms 2 Yes Yes /classes/Product.php:4578
102
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 286) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.107 ms 2 Yes /classes/SpecificPrice.php:576
199
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 295) AND (b.`id_shop` = 1) LIMIT 1
1.107 ms 1 /src/Adapter/EntityMapper.php:71
960
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3214
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.104 ms 2 Yes Yes /classes/Product.php:4578
300
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 304) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.102 ms 2 Yes /classes/SpecificPrice.php:576
124
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 288) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.101 ms 2 Yes /classes/SpecificPrice.php:576
333
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 307) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.101 ms 2 Yes /classes/SpecificPrice.php:576
864
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8388
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.099 ms 2 Yes Yes /classes/Product.php:4578
1056
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4632
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.099 ms 2 Yes Yes /classes/Product.php:4578
179
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 293) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.099 ms 2 Yes /classes/SpecificPrice.php:576
816
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 1285
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.097 ms 2 Yes Yes /classes/Product.php:4578
223
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 297) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.096 ms 2 Yes /classes/SpecificPrice.php:576
234
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 298) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.091 ms 2 Yes /classes/SpecificPrice.php:576
1097
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 9 AND `id_shop` = 1
1.083 ms 1 /src/Adapter/EntityMapper.php:79
888
SELECT SQL_NO_CACHE ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
IFNULL(stock.quantity, 0) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
product_attribute_shop.`default_on`, pa.`reference`, pa.`ean13`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
pal.`available_now`, pal.`available_later`
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `mangayo_product_attribute_lang` pal
ON (
pa.`id_product_attribute` = pal.`id_product_attribute` AND
pal.`id_lang` = 1)
LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
INNER JOIN mangayo_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 8382
AND al.`id_lang` = 1
AND agl.`id_lang` = 1
GROUP BY id_attribute_group, id_product_attribute
ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
1.083 ms 2 Yes Yes /classes/Product.php:4578
201
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 295) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.080 ms 2 Yes /classes/SpecificPrice.php:576
157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 291) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.079 ms 2 Yes /classes/SpecificPrice.php:576
75
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 284) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.072 ms 2 Yes /classes/SpecificPrice.php:576
135
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 289) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.072 ms 2 Yes /classes/SpecificPrice.php:576
289
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 303) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.067 ms 2 Yes /classes/SpecificPrice.php:576
256
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 300) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.063 ms 2 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 301) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.063 ms 2 Yes /classes/SpecificPrice.php:576
146
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 290) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.058 ms 2 Yes /classes/SpecificPrice.php:576
190
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 294) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.056 ms 2 Yes /classes/SpecificPrice.php:576
168
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 292) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.055 ms 2 Yes /classes/SpecificPrice.php:576
278
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 302) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.045 ms 2 Yes /classes/SpecificPrice.php:576
113
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 287) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.043 ms 2 Yes /classes/SpecificPrice.php:576
374
SELECT SQL_NO_CACHE t.*,
tl.*
FROM `mangayo_hicookietype` t
LEFT JOIN `mangayo_hicookietype_lang` `tl` ON t.`id_type` = tl.`id_type`
LEFT JOIN `mangayo_hicookietype_shop` `ts` ON t.`id_type` = ts.`id_type`
WHERE (tl.`id_lang` = 1) AND (ts.`id_shop` = 1)
ORDER BY t.position
1.037 ms 9 Yes /modules/hicookielaw/classes/type.php:68
322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 306) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.034 ms 2 Yes /classes/SpecificPrice.php:576
212
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 296) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
1.029 ms 2 Yes /classes/SpecificPrice.php:576
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
1.022 ms 130 /classes/module/Module.php:345
384
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
0.992 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
1071
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
0.940 ms 40 Yes /classes/Manufacturer.php:211
18
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `mangayo_meta` m
LEFT JOIN `mangayo_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.936 ms 59 Yes /classes/Dispatcher.php:654
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 289 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 289 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.932 ms 0 /classes/Cart.php:1410
129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 288 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 288 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.905 ms 0 /classes/Cart.php:1410
184
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 293 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.903 ms 0 /classes/Cart.php:1410
239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 298 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.898 ms 0 /classes/Cart.php:1410
294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 303 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.894 ms 0 /classes/Cart.php:1410
151
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 290 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 290 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.893 ms 0 /classes/Cart.php:1410
217
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 296 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.892 ms 0 /classes/Cart.php:1410
338
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 307 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.891 ms 0 /classes/Cart.php:1410
107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 286 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.888 ms 0 /classes/Cart.php:1410
96
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 285 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.886 ms 0 /classes/Cart.php:1410
118
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 287 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.883 ms 0 /classes/Cart.php:1410
261
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 300 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 300 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.882 ms 0 /classes/Cart.php:1410
37
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `mangayo_module` m
LEFT JOIN `mangayo_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.882 ms 130 /classes/module/Module.php:345
272
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 301 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 301 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.881 ms 0 /classes/Cart.php:1410
173
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 292 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 292 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.877 ms 0 /classes/Cart.php:1410
327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 306 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.877 ms 0 /classes/Cart.php:1410
250
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 299 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 299 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.876 ms 0 /classes/Cart.php:1410
206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 295 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.876 ms 0 /classes/Cart.php:1410
84
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 284 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.874 ms 0 /classes/Cart.php:1410
162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 291 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 291 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.874 ms 0 /classes/Cart.php:1410
283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 302 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.868 ms 0 /classes/Cart.php:1410
753
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
0.868 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
779
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `mangayo_category` c
INNER JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `mangayo_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 6
AND nleft >= 11 AND nright <= 28
AND c.id_category IN (
SELECT id_category
FROM `mangayo_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cs.`position` ASC
0.867 ms 9 Yes /modules/ps_categorytree/ps_categorytree.php:166
228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 297 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.864 ms 0 /classes/Cart.php:1410
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 294 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 294 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.859 ms 0 /classes/Cart.php:1410
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 304 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.857 ms 0 /classes/Cart.php:1410
97
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 285
ORDER BY f.position ASC
0.852 ms 7 Yes /classes/Product.php:5993
316
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 305 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.846 ms 0 /classes/Cart.php:1410
382
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `mangayo_feature` f  INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `mangayo_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `mangayo_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.845 ms 49 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
152
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 290
ORDER BY f.position ASC
0.843 ms 7 Yes /classes/Product.php:5993
59
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`, cl.`link_rewrite`, category_shop.`id_shop`
FROM `mangayo_category` c
LEFT JOIN `mangayo_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE `id_lang` = 1
AND c.`id_parent` = 2
AND `active` = 1
GROUP BY c.`id_category`
ORDER BY category_shop.`position` ASC
0.826 ms 15 Yes Yes /classes/Category.php:1148
328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 306
ORDER BY f.position ASC
0.826 ms 7 Yes /classes/Product.php:5993
768
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) as quantity, pl.`description`,
pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
m.`name` AS manufacturer_name,
DATEDIFF(
product_shop.`date_add`,
DATE_SUB(
NOW(),
INTERVAL 10 DAY
)
) > 0 AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
INNER JOIN mangayo_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = 1 AND pl.id_shop = 1 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
LEFT JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1 AND image_shop.cover=1)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = 1
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1 AND product_attribute_shop.default_on = 1)
LEFT JOIN mangayo_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
WHERE (p.`id_product` IN (18))
GROUP BY product_shop.id_product
0.822 ms 0 /modules/an_megamenu/classes/AnDropdown.php:313
612
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3423) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.820 ms 2 Yes /classes/SpecificPrice.php:576
273
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 301
ORDER BY f.position ASC
0.819 ms 7 Yes /classes/Product.php:5993
339
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 307
ORDER BY f.position ASC
0.817 ms 7 Yes /classes/Product.php:5993
240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 298
ORDER BY f.position ASC
0.816 ms 7 Yes /classes/Product.php:5993
163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 291
ORDER BY f.position ASC
0.815 ms 7 Yes /classes/Product.php:5993
218
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 296
ORDER BY f.position ASC
0.815 ms 7 Yes /classes/Product.php:5993
85
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 284
ORDER BY f.position ASC
0.804 ms 7 Yes /classes/Product.php:5993
108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 286
ORDER BY f.position ASC
0.799 ms 7 Yes /classes/Product.php:5993
262
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 300
ORDER BY f.position ASC
0.794 ms 7 Yes /classes/Product.php:5993
221
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 297) AND (b.`id_shop` = 1) LIMIT 1
0.792 ms 1 /src/Adapter/EntityMapper.php:71
130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 288
ORDER BY f.position ASC
0.789 ms 7 Yes /classes/Product.php:5993
185
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 293
ORDER BY f.position ASC
0.789 ms 7 Yes /classes/Product.php:5993
251
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 299
ORDER BY f.position ASC
0.788 ms 7 Yes /classes/Product.php:5993
295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 303
ORDER BY f.position ASC
0.783 ms 7 Yes /classes/Product.php:5993
207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 295
ORDER BY f.position ASC
0.781 ms 7 Yes /classes/Product.php:5993
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 294
ORDER BY f.position ASC
0.781 ms 7 Yes /classes/Product.php:5993
748
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.780 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
188
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 294) AND (b.`id_shop` = 1) LIMIT 1
0.778 ms 1 /src/Adapter/EntityMapper.php:71
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 289
ORDER BY f.position ASC
0.777 ms 7 Yes /classes/Product.php:5993
174
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 292
ORDER BY f.position ASC
0.776 ms 7 Yes /classes/Product.php:5993
133
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 289) AND (b.`id_shop` = 1) LIMIT 1
0.774 ms 1 /src/Adapter/EntityMapper.php:71
435
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8385) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.773 ms 3 Yes /classes/SpecificPrice.php:576
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 304
ORDER BY f.position ASC
0.771 ms 7 Yes /classes/Product.php:5993
119
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 287
ORDER BY f.position ASC
0.770 ms 7 Yes /classes/Product.php:5993
317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 305
ORDER BY f.position ASC
0.770 ms 7 Yes /classes/Product.php:5993
122
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 288) AND (b.`id_shop` = 1) LIMIT 1
0.768 ms 1 /src/Adapter/EntityMapper.php:71
41
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.767 ms 465 /classes/CartRule.php:357
39
SELECT SQL_NO_CACHE 1 FROM `mangayo_cart_rule` WHERE ((date_to >= "2024-06-28 00:00:00" AND date_to <= "2024-06-28 23:59:59") OR (date_from >= "2024-06-28 00:00:00" AND date_from <= "2024-06-28 23:59:59") OR (date_from < "2024-06-28 00:00:00" AND date_to > "2024-06-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.764 ms 465 /classes/CartRule.php:357
284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 302
ORDER BY f.position ASC
0.763 ms 7 Yes /classes/Product.php:5993
243
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 299) AND (b.`id_shop` = 1) LIMIT 1
0.762 ms 1 /src/Adapter/EntityMapper.php:71
229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 297
ORDER BY f.position ASC
0.761 ms 7 Yes /classes/Product.php:5993
254
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 300) AND (b.`id_shop` = 1) LIMIT 1
0.758 ms 1 /src/Adapter/EntityMapper.php:71
383
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
0.758 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
155
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 291) AND (b.`id_shop` = 1) LIMIT 1
0.757 ms 1 /src/Adapter/EntityMapper.php:71
534
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 2348) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.754 ms 2 Yes /classes/SpecificPrice.php:576
177
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 293) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
331
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 307) AND (b.`id_shop` = 1) LIMIT 1
0.751 ms 1 /src/Adapter/EntityMapper.php:71
69
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 284) AND (b.`id_shop` = 1) LIMIT 1
0.747 ms 1 /src/Adapter/EntityMapper.php:71
111
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 287) AND (b.`id_shop` = 1) LIMIT 1
0.747 ms 1 /src/Adapter/EntityMapper.php:71
287
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 303) AND (b.`id_shop` = 1) LIMIT 1
0.746 ms 1 /src/Adapter/EntityMapper.php:71
210
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 296) AND (b.`id_shop` = 1) LIMIT 1
0.745 ms 1 /src/Adapter/EntityMapper.php:71
42
SELECT SQL_NO_CACHE * FROM `mangayo_cart_rule` cr
LEFT JOIN `mangayo_cart_rule_lang` crl ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE ((cr.`id_customer` = 0 OR (cr.`id_customer` = 0 AND (cr.`highlight` = 1 OR cr.`code` = "")))) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.742 ms 1 /classes/CartRule.php:418
298
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 304) AND (b.`id_shop` = 1) LIMIT 1
0.740 ms 1 /src/Adapter/EntityMapper.php:71
19
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) AND (b.`id_shop` = 1) LIMIT 1
0.738 ms 1 /src/Adapter/EntityMapper.php:71
100
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 286) AND (b.`id_shop` = 1) LIMIT 1
0.736 ms 1 /src/Adapter/EntityMapper.php:71
390
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 4 ORDER BY vl.`value` ASC
0.735 ms 157 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
309
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 305) AND (b.`id_shop` = 1) LIMIT 1
0.731 ms 1 /src/Adapter/EntityMapper.php:71
232
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 298) AND (b.`id_shop` = 1) LIMIT 1
0.729 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3369) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.728 ms 2 Yes /classes/SpecificPrice.php:576
276
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 302) AND (b.`id_shop` = 1) LIMIT 1
0.728 ms 1 /src/Adapter/EntityMapper.php:71
523
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 2346) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.725 ms 2 Yes /classes/SpecificPrice.php:576
89
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 285) AND (b.`id_shop` = 1) LIMIT 1
0.724 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 292) AND (b.`id_shop` = 1) LIMIT 1
0.724 ms 1 /src/Adapter/EntityMapper.php:71
265
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 301) AND (b.`id_shop` = 1) LIMIT 1
0.723 ms 1 /src/Adapter/EntityMapper.php:71
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM mangayo_shop_group gs
LEFT JOIN mangayo_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN mangayo_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.720 ms 1 Yes /classes/shop/Shop.php:715
144
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 290) AND (b.`id_shop` = 1) LIMIT 1
0.714 ms 1 /src/Adapter/EntityMapper.php:71
446
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8386) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.714 ms 3 Yes /classes/SpecificPrice.php:576
490
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8382) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.712 ms 3 Yes /classes/SpecificPrice.php:576
388
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 3 ORDER BY vl.`value` ASC
0.712 ms 18 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
556
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3214) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.709 ms 2 Yes /classes/SpecificPrice.php:576
457
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8387) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.709 ms 3 Yes /classes/SpecificPrice.php:576
782
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10559) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.705 ms 1 Yes Yes /classes/Product.php:4504
634
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4207) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.699 ms 2 Yes /classes/SpecificPrice.php:576
1101
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 11 AND `id_shop` = 1
0.698 ms 1 /src/Adapter/EntityMapper.php:79
643
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4632) AND (b.`id_shop` = 1) LIMIT 1
0.698 ms 1 /src/Adapter/EntityMapper.php:71
512
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1426) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.696 ms 2 Yes /classes/SpecificPrice.php:576
517
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1426 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1426 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.695 ms 0 /classes/Cart.php:1410
632
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4207) AND (b.`id_shop` = 1) LIMIT 1
0.694 ms 1 /src/Adapter/EntityMapper.php:71
645
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4632) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.694 ms 2 Yes /classes/SpecificPrice.php:576
595
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3371 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3371 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.692 ms 0 /classes/Cart.php:1410
401
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 10559) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.688 ms 3 Yes /classes/SpecificPrice.php:576
565
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3369) AND (b.`id_shop` = 1) LIMIT 1
0.687 ms 1 /src/Adapter/EntityMapper.php:71
501
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8383) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.686 ms 3 Yes /classes/SpecificPrice.php:576
623
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3669) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.686 ms 2 Yes /classes/SpecificPrice.php:576
763
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 2
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.682 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
656
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4781) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.680 ms 2 Yes /classes/SpecificPrice.php:576
433
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8385) AND (b.`id_shop` = 1) LIMIT 1
0.680 ms 1 /src/Adapter/EntityMapper.php:71
479
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8389) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.679 ms 3 Yes /classes/SpecificPrice.php:576
410
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1284) AND (b.`id_shop` = 1) LIMIT 1
0.678 ms 1 /src/Adapter/EntityMapper.php:71
590
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3371) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.675 ms 2 Yes /classes/SpecificPrice.php:576
754
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.672 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
377
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12211) LIMIT 1
0.670 ms 1 /src/Adapter/EntityMapper.php:71
413
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1284) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.665 ms 2 Yes /classes/SpecificPrice.php:576
578
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3370) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.665 ms 2 Yes /classes/SpecificPrice.php:576
878
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8382) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.665 ms 1 Yes Yes /classes/Product.php:4504
769
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 4
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.664 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
518
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1426
ORDER BY f.position ASC
0.662 ms 7 Yes /classes/Product.php:5993
755
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.662 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
1105
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 23 AND `id_shop` = 1
0.661 ms 1 /src/Adapter/EntityMapper.php:79
663
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10559
ORDER BY `position`
0.659 ms 1 Yes /classes/Product.php:3545
392
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `mangayo_category` c
INNER JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `mangayo_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.658 ms 87 Yes /classes/Category.php:721
468
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 8388) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.657 ms 3 Yes /classes/SpecificPrice.php:576
424
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 1285) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.655 ms 2 Yes /classes/SpecificPrice.php:576
545
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 2349) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.654 ms 2 Yes /classes/SpecificPrice.php:576
666
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1284
ORDER BY `position`
0.652 ms 1 Yes /classes/Product.php:3545
114
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 287)
0.648 ms 1 /classes/Product.php:3857
601
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 10, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `mangayo_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 10) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3372) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2024-06-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.639 ms 2 Yes /classes/SpecificPrice.php:576
1034
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4207) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.638 ms 1 Yes Yes /classes/Product.php:4504
422
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1285) AND (b.`id_shop` = 1) LIMIT 1
0.633 ms 1 /src/Adapter/EntityMapper.php:71
506
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8383 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8383 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.633 ms 0 /classes/Cart.php:1410
747
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.633 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `mangayo_hook_alias`
0.631 ms 88 /classes/Hook.php:287
749
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.630 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
794
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1284) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.630 ms 1 Yes Yes /classes/Product.php:4504
442
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8386
AND image_shop.`cover` = 1 LIMIT 1
0.626 ms 1 /classes/Product.php:3570
52
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a0
LEFT JOIN `mangayo_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 11) AND (a0.`nright` > 28) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.624 ms 6 /classes/PrestaShopCollection.php:383
462
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8387 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8387 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.622 ms 0 /classes/Cart.php:1410
17
SELECT SQL_NO_CACHE name, alias FROM `mangayo_hook_alias`
0.621 ms 88 /classes/Hook.php:339
35
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 90) AND (b.`id_shop` = 1) LIMIT 1
0.619 ms 1 /src/Adapter/EntityMapper.php:71
846
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8387 LIMIT 1
0.619 ms 13 /modules/an_wishlist/classes/an_wish_products.php:124
764
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 3
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.618 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
430
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1285
ORDER BY f.position ASC
0.616 ms 7 Yes /classes/Product.php:5993
455
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8387) AND (b.`id_shop` = 1) LIMIT 1
0.616 ms 1 /src/Adapter/EntityMapper.php:71
1022
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3669) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.616 ms 1 Yes Yes /classes/Product.php:4504
76
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 284)
0.616 ms 1 /classes/Product.php:3857
312
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 305)
0.615 ms 1 /classes/Product.php:3857
495
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8382 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8382 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.615 ms 0 /classes/Cart.php:1410
539
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2348 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2348 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.615 ms 0 /classes/Cart.php:1410
34
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 88) AND (b.`id_shop` = 1) LIMIT 1
0.613 ms 1 /src/Adapter/EntityMapper.php:71
491
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8382)
0.611 ms 1 /classes/Product.php:3857
268
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 301)
0.610 ms 1 /classes/Product.php:3857
752
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.609 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
596
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3371
ORDER BY f.position ASC
0.608 ms 7 Yes /classes/Product.php:5993
344
SELECT SQL_NO_CACHE c.id_category, cl.name, cl.link_rewrite FROM mangayo_category c LEFT JOIN mangayo_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN mangayo_category_lang cl ON (cl.id_category = c.id_category AND cl.id_shop = 1 )WHERE c.nleft <= 11 AND c.nright >= 28 AND c.nleft >= 2 AND c.nright <= 173 AND cl.id_lang = 1 AND c.level_depth > 1 ORDER BY c.level_depth ASC
0.607 ms 6 Yes /modules/facebookproductad/lib/moduleTools.php:526
147
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 290)
0.606 ms 1 /classes/Product.php:3857
1104
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 23) LIMIT 1
0.606 ms 1 /src/Adapter/EntityMapper.php:71
762
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.604 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
661
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4781 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4781 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.604 ms 0 /classes/Cart.php:1410
246
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 299)
0.602 ms 1 /classes/Product.php:3857
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM mangayo_shop_url su
LEFT JOIN mangayo_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'mangayo.it' OR su.domain_ssl = 'mangayo.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.601 ms 1 Yes /classes/shop/Shop.php:1364
770
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 13
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.601 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 297)
0.599 ms 1 /classes/Product.php:3857
484
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8389 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8389 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.599 ms 0 /classes/Cart.php:1410
406
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10559 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10559 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.596 ms 0 /classes/Cart.php:1410
550
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2349 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2349 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.596 ms 0 /classes/Cart.php:1410
767
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 5
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.596 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
832
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8386)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.590 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
880
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8382)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.589 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
796
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1284)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.589 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
213
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 296)
0.587 ms 1 /classes/Product.php:3857
930
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 2348 LIMIT 1
0.584 ms 264 /modules/an_wishlist/classes/an_wish_products.php:124
398
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10559) AND (b.`id_shop` = 1) LIMIT 1
0.583 ms 1 /src/Adapter/EntityMapper.php:71
561
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3214 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3214 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.582 ms 0 /classes/Cart.php:1410
650
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4632 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4632 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.581 ms 0 /classes/Cart.php:1410
169
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 292)
0.580 ms 1 /classes/Product.php:3857
610
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3423) AND (b.`id_shop` = 1) LIMIT 1
0.579 ms 1 /src/Adapter/EntityMapper.php:71
98
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 286
AND image_shop.`cover` = 1 LIMIT 1
0.578 ms 1 /classes/Product.php:3570
290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 303)
0.577 ms 1 /classes/Product.php:3857
613
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3423)
0.577 ms 1 /classes/Product.php:3857
92
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 285)
0.576 ms 1 /classes/Product.php:3857
419
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1284
ORDER BY f.position ASC
0.576 ms 7 Yes /classes/Product.php:5993
451
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8386 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8386 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.576 ms 0 /classes/Cart.php:1410
532
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2348) AND (b.`id_shop` = 1) LIMIT 1
0.576 ms 1 /src/Adapter/EntityMapper.php:71
103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 286)
0.575 ms 1 /classes/Product.php:3857
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 294)
0.574 ms 1 /classes/Product.php:3857
579
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3370)
0.574 ms 1 /classes/Product.php:3857
510
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1426) AND (b.`id_shop` = 1) LIMIT 1
0.573 ms 1 /src/Adapter/EntityMapper.php:71
584
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3370
ORDER BY f.position ASC
0.573 ms 7 Yes /classes/Product.php:5993
1107
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php'
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme"
0.571 ms 1 /classes/Smarty/SmartyCustom.php:184
572
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3369 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3369 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.570 ms 0 /classes/Cart.php:1410
429
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1285 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.570 ms 0 /classes/Cart.php:1410
915
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 2346
0.569 ms 3 /classes/Product.php:3423
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 304)
0.568 ms 1 /classes/Product.php:3857
334
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 307)
0.568 ms 1 /classes/Product.php:3857
914
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2346) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.568 ms 1 Yes Yes /classes/Product.php:4504
86
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.568 ms 0 /classes/tax/TaxRulesTaxManager.php:109
543
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2349) AND (b.`id_shop` = 1) LIMIT 1
0.568 ms 1 /src/Adapter/EntityMapper.php:71
874
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8389 LIMIT 1
0.568 ms 1 /classes/Product.php:1106
628
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3669 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3669 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.567 ms 0 /classes/Cart.php:1410
477
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8389) AND (b.`id_shop` = 1) LIMIT 1
0.566 ms 1 /src/Adapter/EntityMapper.php:71
499
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8383) AND (b.`id_shop` = 1) LIMIT 1
0.565 ms 1 /src/Adapter/EntityMapper.php:71
279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 302)
0.564 ms 1 /classes/Product.php:3857
323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 306)
0.564 ms 1 /classes/Product.php:3857
158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 291)
0.563 ms 1 /classes/Product.php:3857
576
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3370) AND (b.`id_shop` = 1) LIMIT 1
0.563 ms 1 /src/Adapter/EntityMapper.php:71
131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 289
AND image_shop.`cover` = 1 LIMIT 1
0.563 ms 1 /classes/Product.php:3570
257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 300)
0.562 ms 1 /classes/Product.php:3857
180
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 293)
0.561 ms 1 /classes/Product.php:3857
583
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3370 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3370 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.561 ms 0 /classes/Cart.php:1410
599
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3372) AND (b.`id_shop` = 1) LIMIT 1
0.561 ms 1 /src/Adapter/EntityMapper.php:71
766
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.560 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
554
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3214) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
473
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8388 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8388 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.558 ms 0 /classes/Cart.php:1410
418
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1284 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.558 ms 0 /classes/Cart.php:1410
1058
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4781) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.558 ms 1 Yes Yes /classes/Product.php:4504
235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 298)
0.557 ms 1 /classes/Product.php:3857
474
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8388
ORDER BY f.position ASC
0.557 ms 7 Yes /classes/Product.php:5993
466
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8388) AND (b.`id_shop` = 1) LIMIT 1
0.555 ms 1 /src/Adapter/EntityMapper.php:71
125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 288)
0.554 ms 1 /classes/Product.php:3857
202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 295)
0.554 ms 1 /classes/Product.php:3857
617
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3423 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3423 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.554 ms 0 /classes/Cart.php:1410
1010
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3423) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.554 ms 1 Yes Yes /classes/Product.php:4504
1078
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.554 ms 1 /classes/Smarty/SmartyCustom.php:265
38
SELECT SQL_NO_CACHE 1 FROM mangayo_cart_product cp INNER JOIN mangayo_product p
ON (p.id_product = cp.id_product) INNER JOIN mangayo_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.553 ms 1 /classes/Cart.php:4192
587
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3371) AND (b.`id_shop` = 1) LIMIT 1
0.552 ms 1 /src/Adapter/EntityMapper.php:71
818
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8385) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.551 ms 1 Yes Yes /classes/Product.php:4504
381
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM mangayo_layered_category
WHERE controller = 'category'
AND id_category = 11
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.550 ms 6 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
977
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.550 ms 1 /modules/an_wishlist/classes/an_wish.php:76
528
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2346 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2346 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.550 ms 0 /classes/Cart.php:1410
178
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.549 ms 1 /classes/SpecificPrice.php:259
109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 287
AND image_shop.`cover` = 1 LIMIT 1
0.548 ms 1 /classes/Product.php:3570
606
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3372 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3372 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.548 ms 0 /classes/Cart.php:1410
208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 296
AND image_shop.`cover` = 1 LIMIT 1
0.547 ms 1 /classes/Product.php:3570
1050
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4632 LIMIT 1
0.547 ms 22 /modules/an_wishlist/classes/an_wish_products.php:124
1092
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 19) LIMIT 1
0.546 ms 1 /src/Adapter/EntityMapper.php:71
1111
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php'
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme"
0.546 ms 1 /classes/Smarty/SmartyCustom.php:184
175
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 293
AND image_shop.`cover` = 1 LIMIT 1
0.545 ms 1 /classes/Product.php:3570
296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 304
AND image_shop.`cover` = 1 LIMIT 1
0.545 ms 1 /classes/Product.php:3570
444
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8386) AND (b.`id_shop` = 1) LIMIT 1
0.545 ms 1 /src/Adapter/EntityMapper.php:71
507
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8383
ORDER BY f.position ASC
0.545 ms 7 Yes /classes/Product.php:5993
639
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4207 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4207 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.545 ms 0 /classes/Cart.php:1410
651
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4632
ORDER BY f.position ASC
0.545 ms 7 Yes /classes/Product.php:5993
1046
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4632) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.545 ms 1 Yes Yes /classes/Product.php:4504
521
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2346) AND (b.`id_shop` = 1) LIMIT 1
0.544 ms 1 /src/Adapter/EntityMapper.php:71
674
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8387
ORDER BY `position`
0.543 ms 1 Yes /classes/Product.php:3545
332
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.543 ms 1 /classes/SpecificPrice.php:259
751
SELECT SQL_NO_CACHE *
FROM `mangayo_andropdown` d
LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
WHERE d.`id_anmenu` = 6
AND `id_lang` = 1
AND `active` = 1
GROUP BY d.`id_andropdown`
ORDER BY d.`position` ASC
0.543 ms 16 Yes Yes /modules/an_megamenu/classes/AnDropdown.php:165
962
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3369) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.542 ms 1 Yes Yes /classes/Product.php:4504
621
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3669) AND (b.`id_shop` = 1) LIMIT 1
0.541 ms 1 /src/Adapter/EntityMapper.php:71
562
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3214
ORDER BY f.position ASC
0.541 ms 7 Yes /classes/Product.php:5993
746
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
0.541 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
573
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3369
ORDER BY f.position ASC
0.540 ms 7 Yes /classes/Product.php:5993
87
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 285
AND image_shop.`cover` = 1 LIMIT 1
0.540 ms 1 /classes/Product.php:3570
407
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10559
ORDER BY f.position ASC
0.539 ms 7 Yes /classes/Product.php:5993
903
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1426
0.539 ms 3 /classes/Product.php:3423
890
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8383) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.538 ms 1 Yes Yes /classes/Product.php:4504
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 289)
0.537 ms 1 /classes/Product.php:3857
854
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8388) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.537 ms 1 Yes Yes /classes/Product.php:4504
902
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1426) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.536 ms 1 Yes Yes /classes/Product.php:4504
80
SELECT SQL_NO_CACHE tr.*
FROM `mangayo_tax_rule` tr
JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 211)
AND ('00133' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '00133')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.536 ms 0 /classes/tax/TaxRulesTaxManager.php:109
440
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `mangayo_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 8385 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 8385 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.536 ms 0 /classes/Cart.php:1410
153
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 291
AND image_shop.`cover` = 1 LIMIT 1
0.535 ms 1 /classes/Product.php:3570
602
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3372)
0.535 ms 1 /classes/Product.php:3857
654
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4781) AND (b.`id_shop` = 1) LIMIT 1
0.535 ms 1 /src/Adapter/EntityMapper.php:71
551
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2349
ORDER BY f.position ASC
0.534 ms 7 Yes /classes/Product.php:5993
670
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8385
ORDER BY `position`
0.534 ms 1 Yes /classes/Product.php:3545
488
SELECT SQL_NO_CACHE *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 8382) AND (b.`id_shop` = 1) LIMIT 1
0.533 ms 1 /src/Adapter/EntityMapper.php:71
1129
INSERT INTO `mangayo_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('7334442', '', 'mangayo.it/11-manga?q=Categoria+-Manhwa-Novel-Seinen+%2FGenere-Erotico-Thriller', '', '2024-06-28 13:07:40')
0.533 ms 1 /classes/ObjectModel.php:622
1131
UPDATE `mangayo_page_viewed`
SET `counter` = `counter` + 1
WHERE `id_date_range` = 9307
AND `id_page` = 48
AND `id_shop` = 1
0.532 ms 1 /classes/Page.php:131
866
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8389) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.530 ms 1 Yes Yes /classes/Product.php:4504
1024
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3669)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.530 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
806
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1285) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.528 ms 1 Yes Yes /classes/Product.php:4504
340
SELECT SQL_NO_CACHE *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 11) LIMIT 1
0.528 ms 1 /src/Adapter/EntityMapper.php:71
441
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8385
ORDER BY f.position ASC
0.528 ms 7 Yes /classes/Product.php:5993
618
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3423
ORDER BY f.position ASC
0.527 ms 7 Yes /classes/Product.php:5993
485
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8389
ORDER BY f.position ASC
0.526 ms 7 Yes /classes/Product.php:5993
274
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 302
AND image_shop.`cover` = 1 LIMIT 1
0.525 ms 1 /classes/Product.php:3570
252
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 300
AND image_shop.`cover` = 1 LIMIT 1
0.524 ms 1 /classes/Product.php:3570
757
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php'
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
0.524 ms 1 /classes/Smarty/SmartyCustom.php:184
998
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3372) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.524 ms 1 Yes Yes /classes/Product.php:4504
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 295
AND image_shop.`cover` = 1 LIMIT 1
0.523 ms 1 /classes/Product.php:3570
662
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4781
ORDER BY f.position ASC
0.523 ms 21 Yes /classes/Product.php:5993
1114
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme" LIMIT 1
0.522 ms 1 /classes/Smarty/SmartyCustom.php:216
496
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8382
ORDER BY f.position ASC
0.521 ms 7 Yes /classes/Product.php:5993
529
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2346
ORDER BY f.position ASC
0.521 ms 7 Yes /classes/Product.php:5993
844
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8387)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.521 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
974
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3370) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.521 ms 1 Yes Yes /classes/Product.php:4504
263
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 301
AND image_shop.`cover` = 1 LIMIT 1
0.520 ms 1 /classes/Product.php:3570
540
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2348
ORDER BY f.position ASC
0.519 ms 7 Yes /classes/Product.php:5993
1088
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) LIMIT 1
0.519 ms 1 /src/Adapter/EntityMapper.php:71
916
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 2346)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.518 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
6
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.517 ms 1 /src/Adapter/EntityMapper.php:71
101
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.517 ms 1 /classes/SpecificPrice.php:259
502
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8383)
0.517 ms 1 /classes/Product.php:3857
307
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 305
AND image_shop.`cover` = 1 LIMIT 1
0.516 ms 1 /classes/Product.php:3570
988
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3371)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.516 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1036
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4207)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.515 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 303
AND image_shop.`cover` = 1 LIMIT 1
0.514 ms 1 /classes/Product.php:3570
1109
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='9b994322a10138ad46146161c46d70ed' AND cache_id="" AND compile_id="charme" LIMIT 1
0.514 ms 1 /classes/Smarty/SmartyCustom.php:216
66
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 284
AND image_shop.`cover` = 1 LIMIT 1
0.513 ms 1 /classes/Product.php:3570
868
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8389)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.513 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 290
AND image_shop.`cover` = 1 LIMIT 1
0.512 ms 1 /classes/Product.php:3570
926
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2348) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.512 ms 1 Yes Yes /classes/Product.php:4504
1094
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 8) LIMIT 1
0.512 ms 1 /src/Adapter/EntityMapper.php:71
627
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3669) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.511 ms 1 /classes/stock/StockAvailable.php:453
842
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8387) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.511 ms 1 Yes Yes /classes/Product.php:4504
1057
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4632
0.511 ms 1 /classes/Product.php:2902
1125
SELECT SQL_NO_CACHE `id_guest`
FROM `mangayo_connections`
WHERE `id_guest` = 7563419
AND `date_add` > '2024-06-28 12:37:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.511 ms 1 Yes /classes/Connection.php:168
913
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1426
0.510 ms 1 /classes/Product.php:2902
463
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8387
ORDER BY f.position ASC
0.509 ms 7 Yes /classes/Product.php:5993
653
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.509 ms 1 /classes/Product.php:5639
971
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3369
ORDER BY `position`
0.509 ms 1 Yes /classes/Product.php:3545
761
SELECT SQL_NO_CACHE *
FROM `mangayo_anmenu` m
LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
WHERE m.`id_shop` = 1
AND `id_lang` = 1
AND `active` = 1
GROUP BY m.`id_anmenu`
ORDER BY m.`position` ASC
0.509 ms 10 Yes Yes /modules/an_megamenu/classes/AnMenu.php:204
952
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3214)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.509 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM mangayo_shop s
LEFT JOIN mangayo_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.508 ms 1 /classes/shop/Shop.php:218
244
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 299
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.508 ms 1 /classes/SpecificPrice.php:259
420
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1285
AND image_shop.`cover` = 1 LIMIT 1
0.508 ms 1 /classes/Product.php:3570
986
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3371) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.508 ms 1 Yes Yes /classes/Product.php:4504
950
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3214) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.507 ms 1 Yes Yes /classes/Product.php:4504
1048
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4632)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.507 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 298
AND image_shop.`cover` = 1 LIMIT 1
0.506 ms 1 /classes/Product.php:3570
318
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 306
AND image_shop.`cover` = 1 LIMIT 1
0.506 ms 1 /classes/Product.php:3570
1012
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3423)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.506 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 292
AND image_shop.`cover` = 1 LIMIT 1
0.505 ms 1 /classes/Product.php:3570
629
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3669
ORDER BY f.position ASC
0.505 ms 7 Yes /classes/Product.php:5993
877
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8389
0.504 ms 1 /classes/Product.php:2902
959
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3214
ORDER BY `position`
0.504 ms 1 Yes /classes/Product.php:3545
241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 299
AND image_shop.`cover` = 1 LIMIT 1
0.503 ms 1 /classes/Product.php:3570
329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 307
AND image_shop.`cover` = 1 LIMIT 1
0.503 ms 1 /classes/Product.php:3570
830
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (8386) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.502 ms 1 Yes Yes /classes/Product.php:4504
845
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.502 ms 1 /modules/an_wishlist/classes/an_wish.php:76
976
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3370)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.502 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
120
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 288
AND image_shop.`cover` = 1 LIMIT 1
0.502 ms 1 /classes/Product.php:3570
1093
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 19 AND `id_shop` = 1
0.502 ms 1 /src/Adapter/EntityMapper.php:79
255
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 300
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.501 ms 1 /classes/SpecificPrice.php:259
904
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1426)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.501 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
607
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3372
ORDER BY f.position ASC
0.500 ms 7 Yes /classes/Product.php:5993
452
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 8386
ORDER BY f.position ASC
0.499 ms 7 Yes /classes/Product.php:5993
219
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 297
AND image_shop.`cover` = 1 LIMIT 1
0.497 ms 1 /classes/Product.php:3570
503
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8383 AND id_shop=1 LIMIT 1
0.495 ms 1 /classes/Product.php:6848
808
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 1285)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.495 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1082
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 1
0.495 ms 1 /src/Adapter/EntityMapper.php:79
123
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 288
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.494 ms 1 /classes/SpecificPrice.php:259
341
SELECT SQL_NO_CACHE *
FROM `mangayo_category_lang`
WHERE `id_category` = 11 AND `id_shop` = 1
0.494 ms 1 /src/Adapter/EntityMapper.php:79
1110
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('9b994322a10138ad46146161c46d70ed',"","charme", FROM_UNIXTIME(1719572860))
0.494 ms 1 /classes/Smarty/SmartyCustom.php:265
186
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 294
AND image_shop.`cover` = 1 LIMIT 1
0.493 ms 1 /classes/Product.php:3570
436
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8385)
0.492 ms 1 /classes/Product.php:3857
378
SELECT SQL_NO_CACHE *
FROM `mangayo_product_lang`
WHERE `id_product` = 12211 AND `id_shop` = 1
0.491 ms 1 /src/Adapter/EntityMapper.php:79
342
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 11) LIMIT 1
0.490 ms 1 /classes/Category.php:1971
708
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4632
ORDER BY `position`
0.490 ms 1 Yes /classes/Product.php:3545
891
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8383
0.490 ms 3 /classes/Product.php:3423
336
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 307 AND `id_group` = 1 LIMIT 1
0.489 ms 0 /classes/GroupReduction.php:156
938
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `mangayo_product_attribute` pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2349) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.489 ms 1 Yes Yes /classes/Product.php:4504
222
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.487 ms 1 /classes/SpecificPrice.php:259
1060
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 63)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 4781)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.487 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
24
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `mangayo_lang` l
JOIN mangayo_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.486 ms 1 /classes/Language.php:1216
45
SELECT SQL_NO_CACHE * FROM `mangayo_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.486 ms 18 Yes /classes/ImageType.php:109
638
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.486 ms 1 /classes/stock/StockAvailable.php:453
640
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM mangayo_feature_product pf
LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN mangayo_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4207
ORDER BY f.position ASC
0.486 ms 14 Yes /classes/Product.php:5993
1085
SELECT SQL_NO_CACHE *
FROM `mangayo_hook` a
WHERE (a.`id_hook` = 35) LIMIT 1
0.485 ms 1 /src/Adapter/EntityMapper.php:71
404
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 10559 AND `id_group` = 1 LIMIT 1
0.484 ms 0 /classes/GroupReduction.php:156
750
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
0.484 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
893
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.483 ms 1 /modules/an_wishlist/classes/an_wish.php:76
431
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8385
AND image_shop.`cover` = 1 LIMIT 1
0.482 ms 1 /classes/Product.php:3570
72
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `from` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
0.482 ms 1 /classes/SpecificPrice.php:377
985
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3370
0.482 ms 1 /classes/Product.php:2902
865
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8388
0.481 ms 1 /classes/Product.php:2902
1118
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php'
WHERE `template_hash`='058b80ee450a0518c27219c45cd7a0d3' AND cache_id="ps_customeraccountlinks|1|1|1|10" AND compile_id="charme"
0.480 ms 1 /classes/Smarty/SmartyCustom.php:184
739
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_shoppingcart" LIMIT 1
0.479 ms 1 /classes/module/Module.php:2636
1123
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_widgets` sw
LEFT JOIN `mangayo_an_trust_badges_widgets_lang` sl 
ON (sw.`id_widget` = sl.`id_widget`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1 
AND sw.`hook`="displayCopyrightContainer"
0.478 ms 2 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php:86
1115
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.477 ms 1 /classes/Smarty/SmartyCustom.php:265
803
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1284
ORDER BY `position`
0.476 ms 1 Yes /classes/Product.php:3545
964
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3369)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.476 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1055
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4632
ORDER BY `position`
0.476 ms 1 Yes /classes/Product.php:3545
1080
SELECT SQL_NO_CACHE lb.`id_link_block`
FROM mangayo_link_block lb
INNER JOIN mangayo_link_block_shop lbs ON lbs.`id_link_block` = lb.`id_link_block`
WHERE lb. `id_hook` = 35 AND lbs.`id_shop` = 1
ORDER by lbs.`position`
0.475 ms 4 Yes /modules/ps_linklist/src/LegacyLinkBlockRepository.php:87
71
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `id_product` != 0 LIMIT 1
0.475 ms 8769 /classes/SpecificPrice.php:297
396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10559
AND image_shop.`cover` = 1 LIMIT 1
0.475 ms 1 /classes/Product.php:3570
896
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8383) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.474 ms 1 /classes/stock/StockAvailable.php:753
820
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8385)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.473 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1128
INSERT IGNORE INTO `mangayo_connections_page` (`id_connections`, `id_page`, `time_start`) VALUES ('7334442', '48', '2024-06-28 13:07:40')
0.473 ms 1 /classes/Connection.php:122
760
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.473 ms 1 /classes/Smarty/SmartyCustom.php:265
853
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8387
0.472 ms 1 /classes/Product.php:2902
856
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8388)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.472 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
940
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 2349)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.472 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1069
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4781
0.472 ms 1 /classes/Product.php:2902
1091
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 1 AND `id_shop` = 1
0.472 ms 1 /src/Adapter/EntityMapper.php:79
1099
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 10 AND `id_shop` = 1
0.472 ms 1 /src/Adapter/EntityMapper.php:79
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `mangayo_lang` l
LEFT JOIN `mangayo_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.471 ms 1 /classes/Language.php:1080
445
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8386
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.471 ms 1 /classes/SpecificPrice.php:259
892
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 8383)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.471 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
148
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 290 AND id_shop=1 LIMIT 1
0.470 ms 1 /classes/Product.php:6848
765
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `mangayo_manufacturer` m
INNER JOIN mangayo_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)
LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)
WHERE m.`id_manufacturer` IN (1)
AND m.`active` = 1
GROUP BY m.`id_manufacturer`
ORDER BY m.`name`
0.469 ms 0 Yes /modules/an_megamenu/classes/AnDropdown.php:345
513
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1426)
0.468 ms 1 /classes/Product.php:3857
791
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10559
ORDER BY `position`
0.467 ms 1 Yes /classes/Product.php:3545
1019
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3423
ORDER BY `position`
0.466 ms 1 Yes /classes/Product.php:3545
805
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1284
0.465 ms 1 /classes/Product.php:2902
408
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1284
AND image_shop.`cover` = 1 LIMIT 1
0.464 ms 1 /classes/Product.php:3570
546
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2349)
0.464 ms 1 /classes/Product.php:3857
735
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 15 AND `id_shop` = 1 LIMIT 1
0.464 ms 1 /classes/module/Module.php:2109
889
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8382
0.464 ms 1 /classes/Product.php:2902
1064
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.464 ms 1 /classes/stock/StockAvailable.php:753
635
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4207)
0.463 ms 1 /classes/Product.php:3857
456
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8387
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.462 ms 1 /classes/SpecificPrice.php:259
588
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 18
AND `active` = 1 LIMIT 1
0.462 ms 1 /classes/Manufacturer.php:316
1000
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 3372)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.461 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1127
SELECT SQL_NO_CACHE `id_page`
FROM `mangayo_page`
WHERE `id_page_type` = 7 AND `id_object` = 11 LIMIT 1
0.460 ms 1 /classes/Page.php:83
941
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.460 ms 1 /modules/an_wishlist/classes/an_wish.php:76
171
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 292 AND `id_group` = 1 LIMIT 1
0.459 ms 0 /classes/GroupReduction.php:156
682
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8383
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
821
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.459 ms 1 /modules/an_wishlist/classes/an_wish.php:76
873
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8389) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.459 ms 1 /classes/stock/StockAvailable.php:806
935
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2348
ORDER BY `position`
0.459 ms 1 Yes /classes/Product.php:3545
156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 291
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.458 ms 1 /classes/SpecificPrice.php:259
696
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3370
ORDER BY `position`
0.458 ms 1 Yes /classes/Product.php:3545
756
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.458 ms 1 /classes/Smarty/SmartyCustom.php:265
8
SELECT SQL_NO_CACHE *
FROM `mangayo_lang` a
LEFT JOIN `mangayo_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.457 ms 1 /src/Adapter/EntityMapper.php:71
211
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.457 ms 1 /classes/SpecificPrice.php:259
955
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3214) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.457 ms 1 /classes/stock/StockAvailable.php:778
337
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.455 ms 1 /classes/stock/StockAvailable.php:453
1084
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block_lang`
WHERE `id_link_block` = 6
0.455 ms 1 /src/Adapter/EntityMapper.php:79
983
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3370
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
22
SELECT SQL_NO_CACHE value FROM `mangayo_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.453 ms 1 /classes/shop/Shop.php:1183
414
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1284)
0.453 ms 1 /classes/Product.php:3857
555
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3214
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.453 ms 1 /classes/SpecificPrice.php:259
644
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4632
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.453 ms 1 /classes/SpecificPrice.php:259
172
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 292) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.452 ms 1 /classes/stock/StockAvailable.php:453
205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.452 ms 1 /classes/stock/StockAvailable.php:453
492
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8382 AND id_shop=1 LIMIT 1
0.452 ms 1 /classes/Product.php:6848
928
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 34, 78)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 2348)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.452 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
1087
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 16 AND `id_shop` = 1
0.452 ms 1 /src/Adapter/EntityMapper.php:79
922
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 2346 LIMIT 1
0.452 ms 1 /classes/Product.php:1106
1031
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3669
ORDER BY `position`
0.451 ms 1 Yes /classes/Product.php:3545
204
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 295 AND `id_group` = 1 LIMIT 1
0.449 ms 0 /classes/GroupReduction.php:156
425
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1285)
0.449 ms 1 /classes/Product.php:3857
20
SELECT SQL_NO_CACHE * FROM `mangayo_currency` c ORDER BY `iso_code` ASC
0.448 ms 1 Yes /classes/Currency.php:709
36
SELECT SQL_NO_CACHE * FROM `mangayo_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.448 ms 1 /classes/module/Module.php:2018
453
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8387
AND image_shop.`cover` = 1 LIMIT 1
0.448 ms 1 /classes/Product.php:3570
464
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8388
AND image_shop.`cover` = 1 LIMIT 1
0.448 ms 1 /classes/Product.php:3570
541
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2349
AND image_shop.`cover` = 1 LIMIT 1
0.448 ms 1 /classes/Product.php:3570
658
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4781 AND id_shop=1 LIMIT 1
0.448 ms 1 /classes/Product.php:6848
458
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8387)
0.447 ms 1 /classes/Product.php:3857
646
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4632)
0.447 ms 1 /classes/Product.php:3857
288
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.447 ms 1 /classes/SpecificPrice.php:259
530
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2348
AND image_shop.`cover` = 1 LIMIT 1
0.445 ms 1 /classes/Product.php:3570
907
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1426) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.445 ms 1 /classes/stock/StockAvailable.php:778
27
SELECT SQL_NO_CACHE *
FROM `mangayo_currency_lang`
WHERE `id_currency` = 1
0.444 ms 1 /src/Adapter/EntityMapper.php:79
73
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE `to` BETWEEN '2024-06-28 00:00:00' AND '2024-06-28 23:59:59' LIMIT 1
0.444 ms 1 /classes/SpecificPrice.php:381
698
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3371
ORDER BY `position`
0.444 ms 1 Yes /classes/Product.php:3545
815
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1285
ORDER BY `position`
0.444 ms 1 Yes /classes/Product.php:3545
1124
SELECT SQL_NO_CACHE * FROM `mangayo_an_trust_badges_icons` sw
WHERE sw.`active`=1
0.444 ms 40 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php:84
684
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1426
ORDER BY `position`
0.443 ms 1 Yes /classes/Product.php:3545
949
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2349
0.443 ms 1 /classes/Product.php:2902
1006
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3372 LIMIT 1
0.443 ms 1 /classes/Product.php:1106
659
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4781 AND `id_group` = 1 LIMIT 1
0.442 ms 0 /classes/GroupReduction.php:156
687
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2346
0.442 ms 1 /classes/Product.php:2902
704
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3669
ORDER BY `position`
0.442 ms 1 Yes /classes/Product.php:3545
375
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "payplug" LIMIT 1
0.442 ms 1 /classes/module/Module.php:2636
672
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8386
ORDER BY `position`
0.441 ms 1 Yes /classes/Product.php:3545
857
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.441 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1038
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4207 LIMIT 1
0.441 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
688
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2348
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
918
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 2346 LIMIT 1
0.440 ms 258 /modules/an_wishlist/classes/an_wish_products.php:124
1052
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4632) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.440 ms 1 /classes/stock/StockAvailable.php:753
1083
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 6) LIMIT 1
0.440 ms 1 /src/Adapter/EntityMapper.php:71
480
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8389)
0.440 ms 1 /classes/Product.php:3857
899
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8383
ORDER BY `position`
0.440 ms 1 Yes /classes/Product.php:3545
953
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.439 ms 1 /modules/an_wishlist/classes/an_wish.php:76
415
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1284 AND id_shop=1 LIMIT 1
0.439 ms 1 /classes/Product.php:6848
566
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3369
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.438 ms 1 /classes/SpecificPrice.php:259
923
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2346
ORDER BY `position`
0.438 ms 1 Yes /classes/Product.php:3545
784
SELECT SQL_NO_CACHE * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
ON (sw.`id_label` = sl.`id_label`
AND sl.`id_lang` = 1)
WHERE sw.`active`=1
AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
AND ((szwr.`type` = 1 AND szwr.`id_type` IN (11, 35, 88)   )
OR (szwr.`type` = 2 AND szwr.`id_type` = 10559)
OR (szwr.`type` = 0 AND szwr.`id_type` = 0)
)
GROUP BY sw.`id_label` ORDER BY sw.`position`
0.437 ms 1 Yes Yes /modules/an_productextratabs/classes/anProductTabsLabels.php:109
947
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2349
ORDER BY `position`
0.437 ms 1 Yes /classes/Product.php:3545
93
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 285 AND id_shop=1 LIMIT 1
0.436 ms 1 /classes/Product.php:6848
1096
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 9) LIMIT 1
0.436 ms 1 /src/Adapter/EntityMapper.php:71
299
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.436 ms 1 /classes/SpecificPrice.php:259
702
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3423
ORDER BY `position`
0.436 ms 1 Yes /classes/Product.php:3545
710
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4781
ORDER BY `position`
0.435 ms 1 Yes /classes/Product.php:3545
1117
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.435 ms 1 /classes/Smarty/SmartyCustom.php:265
1132
SELECT SQL_NO_CACHE data
FROM `mangayo_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.435 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
1067
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4781
ORDER BY `position`
0.434 ms 1 Yes /classes/Product.php:3545
110
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.434 ms 1 /classes/Product.php:5639
112
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.434 ms 1 /classes/SpecificPrice.php:259
519
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2346
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
508
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1426
AND image_shop.`cover` = 1 LIMIT 1
0.433 ms 1 /classes/Product.php:3570
905
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.433 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1061
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.433 ms 1 /modules/an_wishlist/classes/an_wish.php:76
70
SELECT SQL_NO_CACHE 1 FROM `mangayo_specific_price` WHERE id_product = 0 LIMIT 1
0.432 ms 1 /classes/SpecificPrice.php:426
106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.432 ms 1 /classes/stock/StockAvailable.php:453
1126
SELECT SQL_NO_CACHE id_page_type
FROM mangayo_page_type
WHERE name = 'category' LIMIT 1
0.432 ms 1 /classes/Page.php:104
216
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.431 ms 1 /classes/stock/StockAvailable.php:453
700
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3372
ORDER BY `position`
0.431 ms 1 Yes /classes/Product.php:3545
49
SELECT SQL_NO_CACHE *
FROM `mangayo_country` a
LEFT JOIN `mangayo_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.431 ms 1 /src/Adapter/EntityMapper.php:71
64
SELECT SQL_NO_CACHE id_order
FROM `mangayo_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.431 ms 1 /modules/facebookproductad/lib/dao/moduleDao.php:383
115
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 287 AND id_shop=1 LIMIT 1
0.431 ms 1 /classes/Product.php:6848
641
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4632
AND image_shop.`cover` = 1 LIMIT 1
0.431 ms 1 /classes/Product.php:3570
772
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php'
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme"
0.430 ms 1 /classes/Smarty/SmartyCustom.php:184
90
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.429 ms 1 /classes/SpecificPrice.php:259
993
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3371) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.429 ms 1 /classes/stock/StockAvailable.php:806
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.429 ms 1 /classes/stock/StockAvailable.php:453
533
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 2348
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.429 ms 1 /classes/SpecificPrice.php:259
871
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8389) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.429 ms 1 /classes/stock/StockAvailable.php:778
1043
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4207
ORDER BY `position`
0.429 ms 1 Yes /classes/Product.php:3545
557
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3214)
0.428 ms 1 /classes/Product.php:3857
176
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.428 ms 1 /classes/Product.php:5639
1037
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.428 ms 1 /modules/an_wishlist/classes/an_wish.php:76
297
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.427 ms 1 /classes/Product.php:5639
568
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3369)
0.427 ms 1 /classes/Product.php:3857
591
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3371)
0.427 ms 1 /classes/Product.php:3857
619
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3669
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
894
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8383 LIMIT 1
0.426 ms 13 /modules/an_wishlist/classes/an_wish_products.php:124
898
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8383 LIMIT 1
0.426 ms 1 /classes/Product.php:1106
997
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3371
0.426 ms 1 /classes/Product.php:2902
657
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4781)
0.426 ms 1 /classes/Product.php:3857
63
SELECT SQL_NO_CACHE * FROM `mangayo_image_type`
0.425 ms 18 /classes/ImageType.php:161
660
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.425 ms 1 /classes/stock/StockAvailable.php:453
969
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3369) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.425 ms 1 /classes/stock/StockAvailable.php:806
26
SELECT SQL_NO_CACHE *
FROM `mangayo_currency` a
LEFT JOIN `mangayo_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.425 ms 1 /src/Adapter/EntityMapper.php:71
867
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8389
0.425 ms 3 /classes/Product.php:3423
901
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8383
0.425 ms 1 /classes/Product.php:2902
1007
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3372
ORDER BY `position`
0.425 ms 1 Yes /classes/Product.php:3545
839
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8386
ORDER BY `position`
0.424 ms 1 Yes /classes/Product.php:3545
973
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3369
0.423 ms 1 /classes/Product.php:2902
29
SELECT SQL_NO_CACHE *
FROM `mangayo_group` a
LEFT JOIN `mangayo_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.423 ms 1 /src/Adapter/EntityMapper.php:71
744
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.423 ms 1 /classes/Smarty/SmartyCustom.php:265
447
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8386)
0.422 ms 1 /classes/Product.php:3857
586
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.422 ms 1 /classes/Product.php:5639
689
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2348
0.422 ms 1 /classes/Product.php:2902
811
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.422 ms 1 /classes/stock/StockAvailable.php:778
887
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8382
ORDER BY `position`
0.422 ms 1 Yes /classes/Product.php:3545
1103
SELECT SQL_NO_CACHE *
FROM `mangayo_cms_lang`
WHERE `id_cms` = 15 AND `id_shop` = 1
0.422 ms 1 /src/Adapter/EntityMapper.php:79
524
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2346)
0.421 ms 1 /classes/Product.php:3857
980
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.421 ms 1 /classes/stock/StockAvailable.php:753
183
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.421 ms 1 /classes/stock/StockAvailable.php:453
475
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8389
AND image_shop.`cover` = 1 LIMIT 1
0.421 ms 1 /classes/Product.php:3570
1102
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 15) LIMIT 1
0.421 ms 1 /src/Adapter/EntityMapper.php:71
676
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8388
ORDER BY `position`
0.420 ms 1 Yes /classes/Product.php:3545
121
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.419 ms 1 /classes/Product.php:5639
486
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8382
AND image_shop.`cover` = 1 LIMIT 1
0.419 ms 1 /classes/Product.php:3570
851
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8387
ORDER BY `position`
0.419 ms 1 Yes /classes/Product.php:3545
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM mangayo_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.419 ms 1 /classes/shop/ShopUrl.php:182
60
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='compile' LIMIT 1
0.418 ms 1 /classes/Smarty/SmartyCustom.php:96
159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 291 AND id_shop=1 LIMIT 1
0.418 ms 1 /classes/Product.php:6848
95
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.417 ms 1 /classes/stock/StockAvailable.php:453
227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.417 ms 1 /classes/stock/StockAvailable.php:453
535
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2348)
0.417 ms 1 /classes/Product.php:3857
1090
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 1) LIMIT 1
0.417 ms 1 /src/Adapter/EntityMapper.php:71
21
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.416 ms 1 /classes/Language.php:883
308
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.416 ms 1 /classes/Product.php:5639
733
UPDATE `mangayo_smarty_lazy_cache`
SET filepath='/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php'
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme"
0.416 ms 1 /classes/Smarty/SmartyCustom.php:184
3
SELECT SQL_NO_CACHE *
FROM `mangayo_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.415 ms 1 /src/Adapter/EntityMapper.php:71
291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 303 AND id_shop=1 LIMIT 1
0.415 ms 1 /classes/Product.php:6848
379
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 2 LIMIT 1
0.415 ms 0 /classes/Category.php:1375
469
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 8388)
0.415 ms 1 /classes/Product.php:3857
1081
SELECT SQL_NO_CACHE *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = 1
WHERE (a.`id_link_block` = 1) LIMIT 1
0.415 ms 1 /src/Adapter/EntityMapper.php:71
723
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `mangayo_currency` c
LEFT JOIN mangayo_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.415 ms 1 /classes/Currency.php:1136
921
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 2346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.415 ms 1 /classes/stock/StockAvailable.php:806
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 294 AND id_shop=1 LIMIT 1
0.414 ms 1 /classes/Product.php:6848
88
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.414 ms 1 /classes/Product.php:5639
126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 288 AND id_shop=1 LIMIT 1
0.414 ms 1 /classes/Product.php:6848
544
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 2349
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.414 ms 1 /classes/SpecificPrice.php:259
726
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "darkmode" LIMIT 1
0.414 ms 1 /classes/module/Module.php:2636
982
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3370 LIMIT 1
0.414 ms 1 /classes/Product.php:1106
911
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1426
ORDER BY `position`
0.413 ms 1 Yes /classes/Product.php:3545
225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 297 AND id_shop=1 LIMIT 1
0.413 ms 1 /classes/Product.php:6848
277
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.413 ms 1 /classes/SpecificPrice.php:259
552
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3214
AND image_shop.`cover` = 1 LIMIT 1
0.413 ms 1 /classes/Product.php:3570
951
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3214
0.413 ms 2 /classes/Product.php:3423
138
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 289 AND `id_group` = 1 LIMIT 1
0.412 ms 0 /classes/GroupReduction.php:156
7
SELECT SQL_NO_CACHE *
FROM `mangayo_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.412 ms 1 /src/Adapter/EntityMapper.php:71
117
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.412 ms 1 /classes/stock/StockAvailable.php:453
214
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 296 AND id_shop=1 LIMIT 1
0.412 ms 1 /classes/Product.php:6848
810
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1285 LIMIT 1
0.412 ms 269 /modules/an_wishlist/classes/an_wish_products.php:124
249
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 299) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.411 ms 1 /classes/stock/StockAvailable.php:453
403
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 10559 AND id_shop=1 LIMIT 1
0.411 ms 1 /classes/Product.php:6848
481
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8389 AND id_shop=1 LIMIT 1
0.411 ms 1 /classes/Product.php:6848
553
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.411 ms 1 /classes/Product.php:5639
690
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2349
ORDER BY `position`
0.411 ms 1 Yes /classes/Product.php:3545
77
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 284 AND id_shop=1 LIMIT 1
0.410 ms 1 /classes/Product.php:6848
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 289) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.410 ms 1 /classes/stock/StockAvailable.php:453
315
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.410 ms 1 /classes/stock/StockAvailable.php:453
1011
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3423
0.410 ms 3 /classes/Product.php:3423
187
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.410 ms 1 /classes/Product.php:5639
376
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 131 AND `id_shop` = 1 LIMIT 1
0.410 ms 1 /classes/module/Module.php:2109
585
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3371
AND image_shop.`cover` = 1 LIMIT 1
0.410 ms 1 /classes/Product.php:3570
1086
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 16) LIMIT 1
0.410 ms 1 /src/Adapter/EntityMapper.php:71
247
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 299 AND id_shop=1 LIMIT 1
0.409 ms 1 /classes/Product.php:6848
48
SELECT SQL_NO_CACHE *
FROM `mangayo_state` a
WHERE (a.`id_state` = 211) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
55
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 142 AND `id_shop` = 1 LIMIT 1
0.409 ms 0 /classes/module/Module.php:2109
242
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.409 ms 1 /classes/Product.php:5639
958
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3214 LIMIT 1
0.409 ms 1 /classes/Product.php:1106
128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 288) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.408 ms 1 /classes/stock/StockAvailable.php:453
1066
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4781 LIMIT 1
0.408 ms 1 /classes/Product.php:1106
145
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 290
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.407 ms 1 /classes/SpecificPrice.php:259
275
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.407 ms 1 /classes/Product.php:5639
624
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3669)
0.407 ms 1 /classes/Product.php:3857
668
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 1285
ORDER BY `position`
0.407 ms 1 Yes /classes/Product.php:3545
280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 302 AND id_shop=1 LIMIT 1
0.406 ms 1 /classes/Product.php:6848
402
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10559)
0.406 ms 1 /classes/Product.php:3857
679
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8389
0.406 ms 1 /classes/Product.php:2902
942
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 2349 LIMIT 1
0.406 ms 267 /modules/an_wishlist/classes/an_wish_products.php:124
1003
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3372) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.406 ms 1 /classes/stock/StockAvailable.php:778
346
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 14 LIMIT 1
0.406 ms 1 /classes/Hook.php:244
67
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `mangayo_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 11 LIMIT 1
0.405 ms 1 /classes/Category.php:1375
608
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3423
AND image_shop.`cover` = 1 LIMIT 1
0.405 ms 1 /classes/Product.php:3570
271
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 301) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.405 ms 1 /classes/stock/StockAvailable.php:453
1098
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 10) LIMIT 1
0.405 ms 1 /src/Adapter/EntityMapper.php:71
233
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.404 ms 1 /classes/SpecificPrice.php:259
597
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3372
AND image_shop.`cover` = 1 LIMIT 1
0.404 ms 1 /classes/Product.php:3570
694
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3369
ORDER BY `position`
0.404 ms 1 Yes /classes/Product.php:3545
181
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 293 AND id_shop=1 LIMIT 1
0.403 ms 1 /classes/Product.php:6848
827
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8385
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
165
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.403 ms 1 /classes/Product.php:5639
209
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.403 ms 1 /classes/Product.php:5639
238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.403 ms 1 /classes/stock/StockAvailable.php:453
692
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3214
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
863
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8388
ORDER BY `position`
0.403 ms 1 Yes /classes/Product.php:3545
132
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.402 ms 1 /classes/Product.php:5639
154
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.402 ms 1 /classes/Product.php:5639
319
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.402 ms 1 /classes/Product.php:5639
1049
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.402 ms 1 /modules/an_wishlist/classes/an_wish.php:76
335
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 307 AND id_shop=1 LIMIT 1
0.401 ms 1 /classes/Product.php:6848
721
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.401 ms 1 /classes/module/Module.php:2636
732
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('4a4b03e34f9266c4e082efcc7a2e039e',"","charme", FROM_UNIXTIME(1719572860))
0.401 ms 1 /classes/Smarty/SmartyCustom.php:265
1100
SELECT SQL_NO_CACHE *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 11) LIMIT 1
0.401 ms 1 /src/Adapter/EntityMapper.php:71
310
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.400 ms 1 /classes/SpecificPrice.php:259
1119
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_copyright" LIMIT 1
0.400 ms 1 /classes/module/Module.php:2636
30
SELECT SQL_NO_CACHE *
FROM `mangayo_group_lang`
WHERE `id_group` = 1
0.400 ms 1 /src/Adapter/EntityMapper.php:79
150
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 290) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.399 ms 1 /classes/stock/StockAvailable.php:453
686
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 2346
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
678
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8389
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
706
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4207
ORDER BY `position`
0.399 ms 1 Yes /classes/Product.php:3545
421
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.398 ms 1 /classes/Product.php:5639
995
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3371
ORDER BY `position`
0.398 ms 1 Yes /classes/Product.php:3545
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 289 AND id_shop=1 LIMIT 1
0.398 ms 1 /classes/Product.php:6848
858
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8388 LIMIT 1
0.398 ms 12 /modules/an_wishlist/classes/an_wish_products.php:124
869
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.398 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1025
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.398 ms 1 /modules/an_wishlist/classes/an_wish.php:76
850
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8387 LIMIT 1
0.397 ms 1 /classes/Product.php:1106
883
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8382) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.397 ms 1 /classes/stock/StockAvailable.php:778
1014
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3423 LIMIT 1
0.397 ms 71 /modules/an_wishlist/classes/an_wish_products.php:124
99
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.396 ms 1 /classes/Product.php:5639
269
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 301 AND id_shop=1 LIMIT 1
0.396 ms 1 /classes/Product.php:6848
324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 306 AND id_shop=1 LIMIT 1
0.395 ms 1 /classes/Product.php:6848
809
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.395 ms 1 /modules/an_wishlist/classes/an_wish.php:76
970
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3369 LIMIT 1
0.395 ms 1 /classes/Product.php:1106
978
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3370 LIMIT 1
0.395 ms 18 /modules/an_wishlist/classes/an_wish_products.php:124
1062
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 4781 LIMIT 1
0.395 ms 30 /modules/an_wishlist/classes/an_wish_products.php:124
1077
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='14f3e6d3f5719f729bfd1d7275ccfb82' AND cache_id="ps_linklist|displayFooter|1|1|1|10" AND compile_id="charme" LIMIT 1
0.395 ms 0 /classes/Smarty/SmartyCustom.php:216
50
SELECT SQL_NO_CACHE *
FROM `mangayo_country_lang`
WHERE `id_country` = 10
0.394 ms 1 /src/Adapter/EntityMapper.php:79
330
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.394 ms 1 /classes/Product.php:5639
497
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 8383
AND image_shop.`cover` = 1 LIMIT 1
0.394 ms 1 /classes/Product.php:3570
875
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8389
ORDER BY `position`
0.394 ms 1 Yes /classes/Product.php:3545
189
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 294
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.394 ms 1 /classes/SpecificPrice.php:259
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 294) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.394 ms 1 /classes/stock/StockAvailable.php:453
667
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1284
0.393 ms 1 /classes/Product.php:2902
23
SELECT SQL_NO_CACHE c.id_currency
FROM `mangayo_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.393 ms 1 /classes/Currency.php:893
743
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='7b251318953b1993e382b80144899c17' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
0.392 ms 0 /classes/Smarty/SmartyCustom.php:216
134
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 289
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.392 ms 1 /classes/SpecificPrice.php:259
161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 291) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.392 ms 1 /classes/stock/StockAvailable.php:453
182
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 293 AND `id_group` = 1 LIMIT 1
0.392 ms 0 /classes/GroupReduction.php:156
292
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 303 AND `id_group` = 1 LIMIT 1
0.392 ms 0 /classes/GroupReduction.php:156
293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.392 ms 1 /classes/stock/StockAvailable.php:453
759
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.392 ms 1 /classes/Smarty/SmartyCustom.php:265
917
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.392 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1039
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.392 ms 1 /classes/stock/StockAvailable.php:778
170
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 292 AND id_shop=1 LIMIT 1
0.391 ms 1 /classes/Product.php:6848
282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.391 ms 1 /classes/stock/StockAvailable.php:453
348
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_searchbar" LIMIT 1
0.391 ms 1 /classes/module/Module.php:2636
563
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3369
AND image_shop.`cover` = 1 LIMIT 1
0.391 ms 1 /classes/Product.php:3570
680
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 8382
ORDER BY `position`
0.391 ms 1 Yes /classes/Product.php:3545
1079
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.391 ms 1 /classes/Smarty/SmartyCustom.php:265
526
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 2346 AND `id_group` = 1 LIMIT 1
0.390 ms 0 /classes/GroupReduction.php:156
630
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4207
AND image_shop.`cover` = 1 LIMIT 1
0.390 ms 1 /classes/Product.php:3570
833
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.390 ms 1 /modules/an_wishlist/classes/an_wish.php:76
847
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8387) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:778
326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.390 ms 1 /classes/stock/StockAvailable.php:453
105
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 286 AND `id_group` = 1 LIMIT 1
0.389 ms 0 /classes/GroupReduction.php:156
742
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.389 ms 1 /classes/module/Module.php:2109
831
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8386
0.389 ms 3 /classes/Product.php:3423
1045
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4207
0.389 ms 1 /classes/Product.php:2902
220
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.388 ms 1 /classes/Product.php:5639
25
SELECT SQL_NO_CACHE `id_lang` FROM `mangayo_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.388 ms 1 /classes/Language.php:883
931
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.388 ms 1 /classes/stock/StockAvailable.php:778
28
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.387 ms 1 /classes/ObjectModel.php:1729
286
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.387 ms 1 /classes/Product.php:5639
505
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8383) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.387 ms 1 /classes/stock/StockAvailable.php:453
703
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3423
0.387 ms 1 /classes/Product.php:2902
731
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='4a4b03e34f9266c4e082efcc7a2e039e' AND cache_id="" AND compile_id="charme" LIMIT 1
0.387 ms 0 /classes/Smarty/SmartyCustom.php:216
776
SELECT SQL_NO_CACHE `iso_code`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.387 ms 1 /classes/Country.php:275
281
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 302 AND `id_group` = 1 LIMIT 1
0.386 ms 0 /classes/GroupReduction.php:156
771
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('1e1b9ef5a77a3e0d0d7e083a6e583010',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.386 ms 1 /classes/Smarty/SmartyCustom.php:265
885
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8382) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.386 ms 1 /classes/stock/StockAvailable.php:806
1004
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3372) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.386 ms 1 /classes/stock/StockAvailable.php:753
32
SELECT SQL_NO_CACHE ctg.`id_group`
FROM mangayo_category_group ctg
WHERE ctg.`id_category` = 11 AND ctg.`id_group` = 1 LIMIT 1
0.385 ms 1 /classes/Category.php:1751
53
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_homecategories" LIMIT 1
0.385 ms 0 /classes/module/Module.php:2636
313
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 305 AND id_shop=1 LIMIT 1
0.385 ms 1 /classes/Product.php:6848
411
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 7
AND `active` = 1 LIMIT 1
0.385 ms 1 /classes/Manufacturer.php:316
841
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8386
0.385 ms 1 /classes/Product.php:2902
925
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2346
0.385 ms 1 /classes/Product.php:2902
248
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 299 AND `id_group` = 1 LIMIT 1
0.385 ms 0 /classes/GroupReduction.php:156
83
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.384 ms 1 /classes/stock/StockAvailable.php:453
167
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 292
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.384 ms 1 /classes/SpecificPrice.php:259
253
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.384 ms 1 /classes/Product.php:5639
432
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.384 ms 1 /classes/Product.php:5639
798
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1284 LIMIT 1
0.384 ms 248 /modules/an_wishlist/classes/an_wish_products.php:124
884
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8382) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.384 ms 1 /classes/stock/StockAvailable.php:753
343
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = 2) LIMIT 1
0.384 ms 1 /classes/Category.php:1971
260
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 300) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:453
266
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 301
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.383 ms 1 /classes/SpecificPrice.php:259
835
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8386) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.383 ms 1 /classes/stock/StockAvailable.php:778
51
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM mangayo_required_field
0.383 ms 1 /classes/ObjectModel.php:1592
231
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.383 ms 1 /classes/Product.php:5639
258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 300 AND id_shop=1 LIMIT 1
0.383 ms 1 /classes/Product.php:6848
380
SELECT SQL_NO_CACHE e.`id_product` as id
FROM `mangayo_product` e
WHERE (e.`id_product` = 12211) LIMIT 1
0.383 ms 1 /classes/ObjectModel.php:2029
574
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3370
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 1 /classes/Product.php:3570
652
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `mangayo_image` i
INNER JOIN mangayo_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4781
AND image_shop.`cover` = 1 LIMIT 1
0.382 ms 1 /classes/Product.php:3570
198
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.382 ms 1 /classes/Product.php:5639
325
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 306 AND `id_group` = 1 LIMIT 1
0.382 ms 0 /classes/GroupReduction.php:156
834
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8386 LIMIT 1
0.382 ms 14 /modules/an_wishlist/classes/an_wish_products.php:124
1013
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.382 ms 1 /modules/an_wishlist/classes/an_wish.php:76
47
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.381 ms 1 /classes/Country.php:402
104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 286 AND id_shop=1 LIMIT 1
0.381 ms 1 /classes/Product.php:6848
193
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 294 AND `id_group` = 1 LIMIT 1
0.381 ms 0 /classes/GroupReduction.php:156
259
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 300 AND `id_group` = 1 LIMIT 1
0.381 ms 0 /classes/GroupReduction.php:156
264
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.381 ms 1 /classes/Product.php:5639
564
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.381 ms 1 /classes/Product.php:5639
946
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 2349 LIMIT 1
0.381 ms 1 /classes/Product.php:1106
31
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.380 ms 1 /classes/ObjectModel.php:1729
54
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "productcomments" LIMIT 1
0.380 ms 1 /classes/module/Module.php:2636
236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 298 AND id_shop=1 LIMIT 1
0.380 ms 1 /classes/Product.php:6848
826
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8385 LIMIT 1
0.380 ms 1 /classes/Product.php:1106
965
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.380 ms 1 /modules/an_wishlist/classes/an_wish.php:76
355
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.379 ms 0 /classes/module/Module.php:2109
571
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3369) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.379 ms 1 /classes/stock/StockAvailable.php:453
738
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.379 ms 1 /modules/an_wishlist/classes/an_wish.php:76
814
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1285 LIMIT 1
0.379 ms 1 /classes/Product.php:1106
910
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1426 LIMIT 1
0.379 ms 1 /classes/Product.php:1106
270
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 301 AND `id_group` = 1 LIMIT 1
0.379 ms 0 /classes/GroupReduction.php:156
989
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.378 ms 1 /modules/an_wishlist/classes/an_wish.php:76
881
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.377 ms 1 /modules/an_wishlist/classes/an_wish.php:76
691
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2349
0.377 ms 1 /classes/Product.php:2902
62
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "btfacebookchats" LIMIT 1
0.376 ms 0 /classes/module/Module.php:2636
74
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.376 ms 1 /classes/SpecificPrice.php:259
357
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.376 ms 0 /classes/module/Module.php:2109
843
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8387
0.376 ms 3 /classes/Product.php:3423
1033
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3669
0.376 ms 1 /classes/Product.php:2902
1112
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customeraccountlinks" LIMIT 1
0.376 ms 1 /classes/module/Module.php:2636
356
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ttblocksearch" LIMIT 1
0.375 ms 0 /classes/module/Module.php:2636
399
SELECT SQL_NO_CACHE `name`
FROM `mangayo_manufacturer`
WHERE `id_manufacturer` = 5
AND `active` = 1 LIMIT 1
0.375 ms 1 /classes/Manufacturer.php:316
560
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3214) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:453
580
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3370 AND id_shop=1 LIMIT 1
0.375 ms 1 /classes/Product.php:6848
724
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_client_service" LIMIT 1
0.375 ms 1 /classes/module/Module.php:2636
774
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 88 AND `id_shop` = 1 LIMIT 1
0.375 ms 1 /classes/module/Module.php:2109
788
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 10559) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:753
789
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 10559) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:806
825
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8385) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:806
1065
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.375 ms 1 /classes/stock/StockAvailable.php:806
160
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 291 AND `id_group` = 1 LIMIT 1
0.374 ms 0 /classes/GroupReduction.php:156
537
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 2348 AND `id_group` = 1 LIMIT 1
0.374 ms 0 /classes/GroupReduction.php:156
303
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 304 AND `id_group` = 1 LIMIT 1
0.373 ms 0 /classes/GroupReduction.php:156
226
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 297 AND `id_group` = 1 LIMIT 1
0.373 ms 0 /classes/GroupReduction.php:156
669
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1285
0.373 ms 1 /classes/Product.php:2902
68
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.372 ms 1 /classes/Product.php:5639
350
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "leoproductsearch" LIMIT 1
0.372 ms 0 /classes/module/Module.php:2636
363
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.372 ms 0 /classes/module/Module.php:2109
200
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.372 ms 1 /classes/SpecificPrice.php:259
314
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 305 AND `id_group` = 1 LIMIT 1
0.372 ms 0 /classes/GroupReduction.php:156
397
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.372 ms 1 /classes/Product.php:5639
470
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8388 AND id_shop=1 LIMIT 1
0.372 ms 1 /classes/Product.php:6848
741
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_logo" LIMIT 1
0.372 ms 1 /classes/module/Module.php:2636
358
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labblocksearch" LIMIT 1
0.371 ms 0 /classes/module/Module.php:2636
1023
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3669
0.371 ms 2 /classes/Product.php:3423
46
SELECT SQL_NO_CACHE format
FROM `mangayo_address_format`
WHERE `id_country` = 10 LIMIT 1
0.370 ms 1 /classes/AddressFormat.php:656
57
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_reviews" LIMIT 1
0.370 ms 0 /classes/module/Module.php:2636
61
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.370 ms 0 /classes/module/Module.php:2636
362
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tvcmssearch" LIMIT 1
0.370 ms 0 /classes/module/Module.php:2636
730
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_flush) as last_flush FROM `mangayo_smarty_last_flush` WHERE type='template' LIMIT 1
0.370 ms 1 /classes/Smarty/SmartyCustom.php:143
1042
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4207 LIMIT 1
0.370 ms 1 /classes/Product.php:1106
1076
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.370 ms 1 /classes/module/Module.php:2109
1122
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 150 AND `id_shop` = 1 LIMIT 1
0.370 ms 1 /classes/module/Module.php:2109
81
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 284 AND `id_group` = 1 LIMIT 1
0.370 ms 0 /classes/GroupReduction.php:156
705
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3669
0.369 ms 1 /classes/Product.php:2902
920
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:753
143
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.369 ms 1 /classes/Product.php:5639
509
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.368 ms 1 /classes/Product.php:5639
127
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 288 AND `id_group` = 1 LIMIT 1
0.368 ms 0 /classes/GroupReduction.php:156
489
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8382
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.368 ms 1 /classes/SpecificPrice.php:259
345
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.367 ms 0 /classes/module/Module.php:2636
349
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 25 AND `id_shop` = 1 LIMIT 1
0.367 ms 1 /classes/module/Module.php:2109
353
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.367 ms 0 /classes/module/Module.php:2109
405
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 10559) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.367 ms 1 /classes/stock/StockAvailable.php:453
956
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3214) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.367 ms 1 /classes/stock/StockAvailable.php:753
1120
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 148 AND `id_shop` = 1 LIMIT 1
0.367 ms 1 /classes/module/Module.php:2109
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 304 AND id_shop=1 LIMIT 1
0.366 ms 1 /classes/Product.php:6848
43
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.366 ms 0 /classes/module/Module.php:2636
558
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3214 AND id_shop=1 LIMIT 1
0.366 ms 1 /classes/Product.php:6848
775
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
0.366 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
849
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8387) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:806
943
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:778
1009
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3372
0.366 ms 1 /classes/Product.php:2902
1054
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 4632 LIMIT 1
0.366 ms 1 /classes/Product.php:1106
547
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 2349 AND id_shop=1 LIMIT 1
0.365 ms 1 /classes/Product.php:6848
967
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3369) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.365 ms 1 /classes/stock/StockAvailable.php:778
1030
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3669 LIMIT 1
0.365 ms 1 /classes/Product.php:1106
1070
SELECT SQL_NO_CACHE *
FROM `mangayo_image_type` a
WHERE (a.`id_image_type` = 14) LIMIT 1
0.365 ms 1 /src/Adapter/EntityMapper.php:71
1106
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('14f3e6d3f5719f729bfd1d7275ccfb82',"ps_linklist|displayFooter|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.364 ms 1 /classes/Smarty/SmartyCustom.php:265
734
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.363 ms 1 /classes/module/Module.php:2636
783
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 10559
0.363 ms 3 /classes/Product.php:3423
823
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8385) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.363 ms 1 /classes/stock/StockAvailable.php:778
1113
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 14 AND `id_shop` = 1 LIMIT 1
0.363 ms 1 /classes/module/Module.php:2109
549
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 2349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
611
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3423
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 1 /classes/SpecificPrice.php:259
745
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('7b251318953b1993e382b80144899c17',"an_megamenu|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.362 ms 1 /classes/Smarty/SmartyCustom.php:265
778
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 10 AND `id_shop` = 1 LIMIT 1
0.362 ms 1 /classes/module/Module.php:2109
944
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:753
149
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 290 AND `id_group` = 1 LIMIT 1
0.362 ms 0 /classes/GroupReduction.php:156
371
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.362 ms 0 /classes/module/Module.php:2109
500
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8383
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.362 ms 1 /classes/SpecificPrice.php:259
773
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "sociallogin" LIMIT 1
0.362 ms 1 /classes/module/Module.php:2636
829
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8385
0.362 ms 1 /classes/Product.php:2902
870
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8389 LIMIT 1
0.362 ms 12 /modules/an_wishlist/classes/an_wish_products.php:124
1018
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3423 LIMIT 1
0.362 ms 1 /classes/Product.php:1106
979
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.361 ms 1 /classes/stock/StockAvailable.php:778
116
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 287 AND `id_group` = 1 LIMIT 1
0.361 ms 0 /classes/GroupReduction.php:156
439
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8385) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.361 ms 1 /classes/stock/StockAvailable.php:453
671
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8385
0.361 ms 1 /classes/Product.php:2902
937
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 2348
0.361 ms 1 /classes/Product.php:2902
44
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.360 ms 0 /classes/module/Module.php:2109
367
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.360 ms 0 /classes/module/Module.php:2109
483
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8389) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.360 ms 1 /classes/stock/StockAvailable.php:453
665
SELECT SQL_NO_CACHE state FROM mangayo_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.360 ms 1 /classes/FeatureFlag.php:105
716
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 48 LIMIT 1
0.360 ms 1 /classes/Hook.php:244
1063
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.360 ms 1 /classes/stock/StockAvailable.php:778
203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 295 AND id_shop=1 LIMIT 1
0.359 ms 1 /classes/Product.php:6848
713
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 76 AND `id_shop` = 1 LIMIT 1
0.359 ms 1 /classes/module/Module.php:2109
797
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.359 ms 1 /modules/an_wishlist/classes/an_wish.php:76
82
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_group`
WHERE `id_group` = 1 LIMIT 1
0.359 ms 1 /classes/Group.php:154
416
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1284 AND `id_group` = 1 LIMIT 1
0.358 ms 0 /classes/GroupReduction.php:156
516
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1426) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:453
522
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 2346
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.358 ms 1 /classes/SpecificPrice.php:259
939
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 2349
0.358 ms 3 /classes/Product.php:3423
351
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.358 ms 0 /classes/module/Module.php:2109
927
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 2348
0.358 ms 3 /classes/Product.php:3423
957
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3214) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.358 ms 1 /classes/stock/StockAvailable.php:806
1075
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_linklist" LIMIT 1
0.358 ms 1 /classes/module/Module.php:2636
879
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8382
0.357 ms 3 /classes/Product.php:3423
1028
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3669) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.357 ms 1 /classes/stock/StockAvailable.php:753
9
SELECT SQL_NO_CACHE id_shop
FROM `mangayo_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.356 ms 1 /classes/ObjectModel.php:1729
785
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.356 ms 1 /modules/an_wishlist/classes/an_wish.php:76
886
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8382 LIMIT 1
0.356 ms 1 /classes/Product.php:1106
465
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.355 ms 1 /classes/Product.php:5639
720
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.355 ms 1 /classes/module/Module.php:2109
819
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8385
0.355 ms 3 /classes/Product.php:3423
1051
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4632) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.355 ms 1 /classes/stock/StockAvailable.php:778
1072
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_contactinfo" LIMIT 1
0.355 ms 1 /classes/module/Module.php:2636
365
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.354 ms 0 /classes/module/Module.php:2109
459
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8387 AND id_shop=1 LIMIT 1
0.354 ms 1 /classes/Product.php:6848
736
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_wishlist" LIMIT 1
0.354 ms 1 /classes/module/Module.php:2636
813
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.354 ms 1 /classes/stock/StockAvailable.php:806
373
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.354 ms 0 /classes/module/Module.php:2109
786
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 10559 LIMIT 1
0.353 ms 5 /modules/an_wishlist/classes/an_wish_products.php:124
961
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3214
0.353 ms 1 /classes/Product.php:2902
369
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.353 ms 0 /classes/module/Module.php:2109
1001
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.353 ms 1 /modules/an_wishlist/classes/an_wish.php:76
1116
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
(`template_hash`, `cache_id`, `compile_id`, `last_update`)
VALUES ('058b80ee450a0518c27219c45cd7a0d3',"ps_customeraccountlinks|1|1|1|10","charme", FROM_UNIXTIME(1719572860))
0.353 ms 1 /classes/Smarty/SmartyCustom.php:265
616
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.352 ms 1 /classes/stock/StockAvailable.php:453
1121
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_trust_badges" LIMIT 1
0.352 ms 1 /classes/module/Module.php:2636
476
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.352 ms 1 /classes/Product.php:5639
559
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3214 AND `id_group` = 1 LIMIT 1
0.352 ms 0 /classes/GroupReduction.php:156
681
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8382
0.352 ms 1 /classes/Product.php:2902
802
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 1284 LIMIT 1
0.352 ms 1 /classes/Product.php:1106
954
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3214 LIMIT 1
0.352 ms 14 /modules/an_wishlist/classes/an_wish_products.php:124
740
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.351 ms 1 /classes/module/Module.php:2109
449
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8386 AND `id_group` = 1 LIMIT 1
0.351 ms 0 /classes/GroupReduction.php:156
494
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8382) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.351 ms 1 /classes/stock/StockAvailable.php:453
780
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_productattributes" LIMIT 1
0.351 ms 1 /classes/module/Module.php:2636
838
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8386 LIMIT 1
0.351 ms 1 /classes/Product.php:1106
1021
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3423
0.351 ms 1 /classes/Product.php:2902
372
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "spsearchpro" LIMIT 1
0.350 ms 0 /classes/module/Module.php:2636
589
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3371
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.350 ms 1 /classes/SpecificPrice.php:259
861
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8388) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:806
908
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1426) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:753
963
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3369
0.350 ms 2 /classes/Product.php:3423
1035
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4207
0.350 ms 2 /classes/Product.php:3423
364
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "stsearchbar" LIMIT 1
0.349 ms 0 /classes/module/Module.php:2636
368
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "bonsearch" LIMIT 1
0.349 ms 0 /classes/module/Module.php:2636
693
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3214
0.349 ms 1 /classes/Product.php:2902
728
SELECT SQL_NO_CACHE *
FROM `mangayo_dark_mode` a
WHERE (a.`id` = 1) LIMIT 1
0.349 ms 1 /src/Adapter/EntityMapper.php:71
855
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 8388
0.349 ms 3 /classes/Product.php:3423
872
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8389) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.349 ms 1 /classes/stock/StockAvailable.php:753
460
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8387 AND `id_group` = 1 LIMIT 1
0.349 ms 0 /classes/GroupReduction.php:156
359
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.348 ms 0 /classes/module/Module.php:2109
472
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8388) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
577
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3370
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.348 ms 1 /classes/SpecificPrice.php:259
1002
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3372 LIMIT 1
0.348 ms 17 /modules/an_wishlist/classes/an_wish_products.php:124
94
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 285 AND `id_group` = 1 LIMIT 1
0.347 ms 0 /classes/GroupReduction.php:156
620
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.347 ms 1 /classes/Product.php:5639
715
SELECT SQL_NO_CACHE `name`
FROM `mangayo_hook`
WHERE `id_hook` = 117 LIMIT 1
0.347 ms 1 /classes/Hook.php:244
609
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.347 ms 1 /classes/Product.php:5639
1073
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 12 AND `id_shop` = 1 LIMIT 1
0.347 ms 1 /classes/module/Module.php:2109
487
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.346 ms 1 /classes/Product.php:5639
647
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4632 AND id_shop=1 LIMIT 1
0.346 ms 1 /classes/Product.php:6848
862
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 8388 LIMIT 1
0.346 ms 1 /classes/Product.php:1106
981
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.346 ms 1 /classes/stock/StockAvailable.php:806
758
SELECT SQL_NO_CACHE UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
WHERE `template_hash`='1e1b9ef5a77a3e0d0d7e083a6e583010' AND cache_id="an_megamenu|1|1|1|10" AND compile_id="charme" LIMIT 1
0.345 ms 0 /classes/Smarty/SmartyCustom.php:216
801
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.345 ms 1 /classes/stock/StockAvailable.php:806
655
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4781
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.344 ms 1 /classes/SpecificPrice.php:259
787
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 10559) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:778
790
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 10559 LIMIT 1
0.344 ms 1 /classes/Product.php:1106
1027
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3669) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:778
1053
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4632) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:806
450
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8386) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.343 ms 1 /classes/stock/StockAvailable.php:453
520
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.343 ms 1 /classes/Product.php:5639
615
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3423 AND `id_group` = 1 LIMIT 1
0.343 ms 0 /classes/GroupReduction.php:156
824
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8385) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.343 ms 1 /classes/stock/StockAvailable.php:753
919
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.343 ms 1 /classes/stock/StockAvailable.php:778
648
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4632 AND `id_group` = 1 LIMIT 1
0.342 ms 0 /classes/GroupReduction.php:156
215
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 296 AND `id_group` = 1 LIMIT 1
0.341 ms 0 /classes/GroupReduction.php:156
448
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8386 AND id_shop=1 LIMIT 1
0.341 ms 1 /classes/Product.php:6848
701
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3372
0.341 ms 1 /classes/Product.php:2902
714
SELECT SQL_NO_CACHE `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=1) AND (`active`= 1)
0.341 ms 3 /modules/sociallogin/models/SocialLoginPosition.php:202
807
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1285
0.341 ms 3 /classes/Product.php:3423
945
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 2349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:806
994
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 3371 LIMIT 1
0.341 ms 1 /classes/Product.php:1106
1015
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.341 ms 1 /classes/stock/StockAvailable.php:778
370
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tdsearchblock" LIMIT 1
0.340 ms 0 /classes/module/Module.php:2636
498
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.340 ms 1 /classes/Product.php:5639
987
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3371
0.340 ms 2 /classes/Product.php:3423
1017
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.340 ms 1 /classes/stock/StockAvailable.php:806
664
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 10559
0.339 ms 1 /classes/Product.php:2902
707
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4207
0.339 ms 1 /classes/Product.php:2902
237
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 298 AND `id_group` = 1 LIMIT 1
0.338 ms 0 /classes/GroupReduction.php:156
366
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "jmsajaxsearch" LIMIT 1
0.338 ms 0 /classes/module/Module.php:2636
718
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 157 AND `id_shop` = 1 LIMIT 1
0.338 ms 1 /classes/module/Module.php:2109
799
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.338 ms 1 /classes/stock/StockAvailable.php:778
822
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8385 LIMIT 1
0.338 ms 12 /modules/an_wishlist/classes/an_wish_products.php:124
906
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 1426 LIMIT 1
0.338 ms 14 /modules/an_wishlist/classes/an_wish_products.php:124
895
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8383) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.338 ms 1 /classes/stock/StockAvailable.php:778
575
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.337 ms 1 /classes/Product.php:5639
909
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 1426) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.337 ms 1 /classes/stock/StockAvailable.php:806
56
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ets_productcomments" LIMIT 1
0.336 ms 0 /classes/module/Module.php:2636
360
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "labsearch" LIMIT 1
0.336 ms 0 /classes/module/Module.php:2636
511
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1426
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.336 ms 1 /classes/SpecificPrice.php:259
582
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:453
859
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8388) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.336 ms 1 /classes/stock/StockAvailable.php:778
604
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3372 AND `id_group` = 1 LIMIT 1
0.335 ms 0 /classes/GroupReduction.php:156
592
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3371 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6848
673
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8386
0.334 ms 1 /classes/Product.php:2902
817
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1285
0.334 ms 1 /classes/Product.php:2902
837
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8386) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.334 ms 1 /classes/stock/StockAvailable.php:806
594
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3371) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
625
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3669 AND id_shop=1 LIMIT 1
0.333 ms 1 /classes/Product.php:6848
683
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8383
0.333 ms 1 /classes/Product.php:2902
695
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3369
0.333 ms 1 /classes/Product.php:2902
975
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3370
0.332 ms 2 /classes/Product.php:3423
409
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.332 ms 1 /classes/Product.php:5639
719
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.332 ms 1 /classes/module/Module.php:2636
933
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 2348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.332 ms 1 /classes/stock/StockAvailable.php:806
1041
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 4207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.332 ms 1 /classes/stock/StockAvailable.php:806
478
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8389
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.331 ms 1 /classes/SpecificPrice.php:259
836
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8386) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:753
1047
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4632
0.331 ms 2 /classes/Product.php:3423
352
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "blocksearch_mod" LIMIT 1
0.331 ms 0 /classes/module/Module.php:2636
454
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.331 ms 1 /classes/Product.php:5639
631
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.331 ms 1 /classes/Product.php:5639
637
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 4207 AND `id_group` = 1 LIMIT 1
0.331 ms 0 /classes/GroupReduction.php:156
793
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 10559
0.331 ms 1 /classes/Product.php:2902
932
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 2348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:753
934
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM mangayo_product_attribute pa
INNER JOIN mangayo_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 2348 LIMIT 1
0.331 ms 1 /classes/Product.php:1106
1016
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.331 ms 1 /classes/stock/StockAvailable.php:753
1026
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3669 LIMIT 1
0.331 ms 10 /modules/an_wishlist/classes/an_wish_products.php:124
354
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "tmsearch" LIMIT 1
0.330 ms 0 /classes/module/Module.php:2636
482
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8389 AND `id_group` = 1 LIMIT 1
0.330 ms 0 /classes/GroupReduction.php:156
515
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1426 AND `id_group` = 1 LIMIT 1
0.330 ms 0 /classes/GroupReduction.php:156
569
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3369 AND id_shop=1 LIMIT 1
0.330 ms 1 /classes/Product.php:6848
1059
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 4781
0.330 ms 3 /classes/Product.php:3423
467
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8388
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.329 ms 1 /classes/SpecificPrice.php:259
636
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 4207 AND id_shop=1 LIMIT 1
0.329 ms 1 /classes/Product.php:6848
709
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4632
0.329 ms 1 /classes/Product.php:2902
717
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_simplefreeshippingline" LIMIT 1
0.329 ms 1 /classes/module/Module.php:2636
727
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 125 AND `id_shop` = 1 LIMIT 1
0.329 ms 1 /classes/module/Module.php:2109
795
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 1284
0.329 ms 3 /classes/Product.php:3423
812
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:753
991
SELECT SQL_NO_CACHE out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3371) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:778
593
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3371 AND `id_group` = 1 LIMIT 1
0.328 ms 0 /classes/GroupReduction.php:156
361
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.328 ms 0 /classes/module/Module.php:2109
417
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.327 ms 1 /classes/stock/StockAvailable.php:453
781
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.327 ms 1 /classes/module/Module.php:2109
426
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1285 AND id_shop=1 LIMIT 1
0.326 ms 1 /classes/Product.php:6848
471
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8388 AND `id_group` = 1 LIMIT 1
0.326 ms 0 /classes/GroupReduction.php:156
493
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8382 AND `id_group` = 1 LIMIT 1
0.326 ms 0 /classes/GroupReduction.php:156
929
SELECT SQL_NO_CACHE `id_wishlist`
FROM `mangayo_an_wishlist`
WHERE `id_customer` = 7563419
AND `is_guest` = 1
AND `id_shop` = 1 LIMIT 1
0.326 ms 1 /modules/an_wishlist/classes/an_wish.php:76
990
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3371 LIMIT 1
0.326 ms 15 /modules/an_wishlist/classes/an_wish_products.php:124
461
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 8387) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.325 ms 1 /classes/stock/StockAvailable.php:453
725
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 147 AND `id_shop` = 1 LIMIT 1
0.325 ms 1 /classes/module/Module.php:2109
712
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "an_theme" LIMIT 1
0.325 ms 1 /classes/module/Module.php:2636
999
SELECT SQL_NO_CACHE `id_category` FROM `mangayo_category_product`
WHERE `id_product` = 3372
0.325 ms 2 /classes/Product.php:3423
600
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3372
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.324 ms 1 /classes/SpecificPrice.php:259
685
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 1426
0.324 ms 1 /classes/Product.php:2902
848
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8387) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.324 ms 1 /classes/stock/StockAvailable.php:753
548
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 2349 AND `id_group` = 1 LIMIT 1
0.323 ms 0 /classes/GroupReduction.php:156
504
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8383 AND `id_group` = 1 LIMIT 1
0.322 ms 0 /classes/GroupReduction.php:156
605
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 3372) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.322 ms 1 /classes/stock/StockAvailable.php:453
968
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3369) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.322 ms 1 /classes/stock/StockAvailable.php:753
1074
SELECT SQL_NO_CACHE `need_identification_number`
FROM `mangayo_country`
WHERE `id_country` = 10 LIMIT 1
0.322 ms 1 /classes/Country.php:402
531
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.321 ms 1 /classes/Product.php:5639
423
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.320 ms 1 /classes/SpecificPrice.php:259
434
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 8385
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.320 ms 1 /classes/SpecificPrice.php:259
626
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3669 AND `id_group` = 1 LIMIT 1
0.320 ms 0 /classes/GroupReduction.php:156
737
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.320 ms 1 /classes/module/Module.php:2109
514
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 1426 AND id_shop=1 LIMIT 1
0.320 ms 1 /classes/Product.php:6848
1005
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3372) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:806
536
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 2348 AND id_shop=1 LIMIT 1
0.319 ms 1 /classes/Product.php:6848
538
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 2348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.319 ms 1 /classes/stock/StockAvailable.php:453
622
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 3669
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 1 /classes/SpecificPrice.php:259
642
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.319 ms 1 /classes/Product.php:5639
897
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 8383) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:806
1029
SELECT SQL_NO_CACHE location
FROM `mangayo_stock_available`
WHERE (id_product = 3669) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.318 ms 1 /classes/stock/StockAvailable.php:806
603
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3372 AND id_shop=1 LIMIT 1
0.318 ms 1 /classes/Product.php:6848
675
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8387
0.318 ms 1 /classes/Product.php:2902
722
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1
0.318 ms 1 /classes/module/Module.php:2109
697
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3370
0.317 ms 1 /classes/Product.php:2902
525
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 2346 AND id_shop=1 LIMIT 1
0.317 ms 1 /classes/Product.php:6848
443
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.316 ms 1 /classes/Product.php:5639
527
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 2346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.316 ms 1 /classes/stock/StockAvailable.php:453
677
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 8388
0.316 ms 1 /classes/Product.php:2902
614
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 3423 AND id_shop=1 LIMIT 1
0.315 ms 1 /classes/Product.php:6848
860
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 8388) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:753
966
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 3369 LIMIT 1
0.314 ms 24 /modules/an_wishlist/classes/an_wish_products.php:124
711
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 4781
0.313 ms 1 /classes/Product.php:2902
992
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 3371) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.313 ms 1 /classes/stock/StockAvailable.php:753
777
SELECT SQL_NO_CACHE `id_module` FROM `mangayo_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.313 ms 1 /classes/module/Module.php:2636
699
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `mangayo_product_attribute`
WHERE `id_product` = 3371
0.312 ms 1 /classes/Product.php:2902
1040
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 4207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.312 ms 1 /classes/stock/StockAvailable.php:753
427
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 1285 AND `id_group` = 1 LIMIT 1
0.311 ms 0 /classes/GroupReduction.php:156
882
SELECT SQL_NO_CACHE COUNT(*)
FROM `mangayo_an_wishlist_products`
WHERE `id_product` = 8382 LIMIT 1
0.309 ms 13 /modules/an_wishlist/classes/an_wish_products.php:124
542
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.308 ms 1 /classes/Product.php:5639
649
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 4632) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.308 ms 1 /classes/stock/StockAvailable.php:453
633
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 4207
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.307 ms 1 /classes/SpecificPrice.php:259
598
SELECT SQL_NO_CACHE name FROM mangayo_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 11 LIMIT 1
0.307 ms 1 /classes/Product.php:5639
428
SELECT SQL_NO_CACHE SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = 1285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.306 ms 1 /classes/stock/StockAvailable.php:453
400
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 10559
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.306 ms 1 /classes/SpecificPrice.php:259
581
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3370 AND `id_group` = 1 LIMIT 1
0.303 ms 0 /classes/GroupReduction.php:156
800
SELECT SQL_NO_CACHE depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = 1284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.303 ms 1 /classes/stock/StockAvailable.php:753
437
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `mangayo_product_shop`
WHERE `id_product` = 8385 AND id_shop=1 LIMIT 1
0.300 ms 1 /classes/Product.php:6848
412
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `mangayo_specific_price_priority`
WHERE `id_product` = 1284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.299 ms 1 /classes/SpecificPrice.php:259
438
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 8385 AND `id_group` = 1 LIMIT 1
0.293 ms 0 /classes/GroupReduction.php:156
570
SELECT SQL_NO_CACHE `reduction`
FROM `mangayo_product_group_reduction_cache`
WHERE `id_product` = 3369 AND `id_group` = 1 LIMIT 1
0.288 ms 0 /classes/GroupReduction.php:156

Doubles

48 queries
SELECT image_shop.`id_image`
                    FROM `mangayo_image` i
                     INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries
SELECT name FROM mangayo_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries
SELECT *
FROM `mangayo_product` a
LEFT JOIN `mangayo_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `mangayo_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `mangayo_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
48 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `mangayo_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
48 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `mangayo_product` p
INNER JOIN `mangayo_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries
                            SELECT `id_tax_rules_group`
                            FROM `mangayo_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries
			SELECT `reduction`
			FROM `mangayo_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries
SELECT SUM(quantity)
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `mangayo_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `mangayo_cart_product` cp JOIN `mangayo_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `mangayo_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM mangayo_feature_product pf
                LEFT JOIN mangayo_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN mangayo_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN mangayo_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN mangayo_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
48 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `mangayo_image` i
             INNER JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `mangayo_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
48 queries
SELECT `id_product_attribute`
            FROM `mangayo_product_attribute`
            WHERE `id_product` = XX
34 queries
SELECT `id_module` FROM `mangayo_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
25 queries
            SELECT `id_wishlist`
            FROM `mangayo_an_wishlist`
            WHERE `id_customer` = XX
            AND `is_guest` = XX
            AND `id_shop` = XX LIMIT XX
24 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `mangayo_product_attribute` pa
             INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `mangayo_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
24 queries
                SELECT `id_category` FROM `mangayo_category_product`
                WHERE `id_product` = XX
24 queries
            SELECT COUNT(*)
            FROM `mangayo_an_wishlist_products`
            WHERE `id_product` = XX LIMIT XX
24 queries
SELECT out_of_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `mangayo_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT product_attribute_shop.id_product_attribute
                FROM mangayo_product_attribute pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
SELECT ag.`id_attribute_group`, ag.`is_color_group`, agl.`name` AS group_name, agl.`public_name` AS public_group_name,
                    a.`id_attribute`, al.`name` AS attribute_name, a.`color` AS attribute_color, product_attribute_shop.`id_product_attribute`,
                    IFNULL(stock.quantity, XX) as quantity, product_attribute_shop.`price`, product_attribute_shop.`ecotax`, product_attribute_shop.`weight`,
                    product_attribute_shop.`default_on`, pa.`reference`, pa.`eanXX`, pa.`mpn`, pa.`upc`, pa.`isbn`, product_attribute_shop.`unit_price_impact`,
                    product_attribute_shop.`minimal_quantity`, product_attribute_shop.`available_date`, ag.`group_type`,
                    pal.`available_now`, pal.`available_later`
                FROM `mangayo_product_attribute` pa
                 INNER JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
                LEFT JOIN `mangayo_product_attribute_lang` pal
                    ON (
                        pa.`id_product_attribute` = pal.`id_product_attribute` AND
                        pal.`id_lang` = XX)
                LEFT JOIN `mangayo_product_attribute_combination` pac ON (pac.`id_product_attribute` = pa.`id_product_attribute`)
                LEFT JOIN `mangayo_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group` ag ON (ag.`id_attribute_group` = a.`id_attribute_group`)
                LEFT JOIN `mangayo_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute`)
                LEFT JOIN `mangayo_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group`)
                 INNER JOIN mangayo_attribute_shop attribute_shop
        ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX)
                WHERE pa.`id_product` = XX
                    AND al.`id_lang` = XX
                    AND agl.`id_lang` = XX
                GROUP BY id_attribute_group, id_product_attribute
                ORDER BY ag.`position` ASC, a.`position` ASC, agl.`name` ASC
16 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
14 queries
SELECT *
            FROM `mangayo_andropdown` d
            LEFT JOIN `mangayo_andropdown_lang` dl ON d.`id_andropdown` = dl.`id_andropdown`
            WHERE d.`id_anmenu` = XX
            AND `id_lang` = XX
            AND `active` = XX
            GROUP BY d.`id_andropdown`
            ORDER BY d.`position` ASC
10 queries
SELECT *
FROM `mangayo_cms` a
LEFT JOIN `mangayo_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = XX
WHERE (a.`id_cms` = XX) LIMIT XX
10 queries
SELECT *
							FROM `mangayo_cms_lang`
							WHERE `id_cms` = XX AND `id_shop` = XX
8 queries
        SELECT * FROM `mangayo_an_productextratabs_labels_relations` szwr, `mangayo_an_productextratabs_labels` sw
        LEFT JOIN `mangayo_an_productextratabs_labels_lang` sl 
            ON (sw.`id_label` = sl.`id_label`
            AND sl.`id_lang` = XX)
        WHERE sw.`active`=XX
            AND sw.`id_label` = szwr.`id_label` AND sw.`relation` = szwr.`type`
            AND ((szwr.`type` = XX AND szwr.`id_type` IN (XX, XX)   )
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                OR (szwr.`type` = XX AND szwr.`id_type` = XX)
                )
         GROUP BY sw.`id_label` ORDER BY sw.`position`
6 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"an_megamenu|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
4 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `mangayo_feature_value` v LEFT JOIN `mangayo_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `mangayo_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries
SELECT *
FROM `mangayo_category` a
LEFT JOIN `mangayo_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `mangayo_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
3 queries
							SELECT `name`
							FROM `mangayo_hook`
							WHERE `id_hook` = XX LIMIT XX
3 queries
				SELECT `name`
				FROM `mangayo_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
3 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_linklist|displayFooter|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
3 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"ps_customeraccountlinks|XX|XX|XX|XX","charme", FROM_UNIXTIME(XX))
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `mangayo_module` m
                LEFT JOIN `mangayo_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `mangayo_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
SELECT XX FROM `mangayo_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
			SELECT `need_identification_number`
			FROM `mangayo_country`
			WHERE `id_country` = XX LIMIT XX
2 queries
		SELECT m.*, ml.`description`, ml.`short_description`
		FROM `mangayo_manufacturer` m INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)INNER JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)WHERE XX AND m.`active` = XX ORDER BY m.`name` ASC
		
2 queries
			SELECT cl.`link_rewrite`
			FROM `mangayo_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
2 queries
				SELECT tr.*
				FROM `mangayo_tax_rule` tr
				JOIN `mangayo_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT c.`nleft`, c.`nright`, c.`level_depth`
FROM `mangayo_category` c
WHERE (c.`id_category` = XX) LIMIT XX
2 queries
SELECT `id_hook`
FROM `mangayo_social_login_position`
WHERE (`id_shop`=XX) AND (`active`= XX)
2 queries
TRUNCATE TABLE `mangayo_smarty_lazy_cache`
2 queries
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="" AND compile_id="charme" LIMIT XX
2 queries
INSERT IGNORE INTO `mangayo_smarty_lazy_cache`
							(`template_hash`, `cache_id`, `compile_id`, `last_update`)
							VALUES (XX,"","charme", FROM_UNIXTIME(XX))
2 queries
SELECT UNIX_TIMESTAMP(last_update) as last_update, filepath FROM `mangayo_smarty_lazy_cache`
							WHERE `template_hash`=XX AND cache_id="an_megamenu|XX|XX|XX|XX" AND compile_id="charme" LIMIT XX
2 queries
SELECT *
            FROM `mangayo_anmenu` m
            LEFT JOIN `mangayo_anmenu_lang` ml ON m.`id_anmenu` = ml.`id_anmenu`
            
            WHERE m.`id_shop` = XX
            AND `id_lang` = XX
            AND `active` = XX
            
            GROUP BY m.`id_anmenu`
            ORDER BY m.`position` ASC
2 queries
SELECT m.*, ml.`description`, ml.`short_description`
            FROM `mangayo_manufacturer` m
             INNER JOIN mangayo_manufacturer_shop manufacturer_shop
        ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = XX)
            LEFT JOIN `mangayo_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = XX)
            WHERE m.`id_manufacturer` IN (XX)
            AND m.`active` = XX
            GROUP BY m.`id_manufacturer`
            ORDER BY m.`name`
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) as quantity, pl.`description`,
            pl.`description_short`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, 
            pl.`meta_title`, pl.`name`, MAX(image_shop.`id_image`) id_image, il.`legend`, 
            m.`name` AS manufacturer_name,
            DATEDIFF(
                product_shop.`date_add`,
                DATE_SUB(
                    NOW(),
                    INTERVAL XX DAY
                )
            ) > XX AS new,
MAX(product_attribute_shop.id_product_attribute) id_product_attribute
FROM `mangayo_product` p
 INNER JOIN mangayo_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `mangayo_product_lang` `pl` ON p.`id_product` = pl.`id_product` AND pl.`id_lang` = XX AND pl.id_shop = XX 
LEFT JOIN `mangayo_image` `i` ON i.`id_product` = p.`id_product`
 LEFT JOIN mangayo_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX AND image_shop.cover=XX)
LEFT JOIN `mangayo_image_lang` `il` ON i.`id_image` = il.`id_image` AND il.`id_lang` = XX
LEFT JOIN `mangayo_manufacturer` `m` ON m.`id_manufacturer` = p.`id_manufacturer`
LEFT OUTER JOIN `mangayo_product_attribute` `pa` ON p.`id_product` = pa.`id_product`
 LEFT JOIN mangayo_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX AND product_attribute_shop.default_on = XX)
 LEFT JOIN mangayo_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = IFNULL(`product_attribute_shop`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
WHERE (p.`id_product` IN (XX))
GROUP BY product_shop.id_product
2 queries
SELECT *
FROM `mangayo_link_block` a
LEFT JOIN `mangayo_link_block_shop` `c` ON a.`id_link_block` = c.`id_link_block` AND c.`id_shop` = XX
WHERE (a.`id_link_block` = XX) LIMIT XX
2 queries
SELECT *
							FROM `mangayo_link_block_lang`
							WHERE `id_link_block` = XX

Tables stress

158 product
157 product_shop
155 stock_available
129 product_attribute
123 product_attribute_shop
99 image_shop
98 image
97 cart_product
71 feature_product
62 category_lang
55 product_attribute_combination
53 product_lang
52 specific_price
52 feature_value_lang
51 image_lang
49 feature_lang
49 feature
49 feature_shop
48 specific_price_priority
48 product_group_reduction_cache
48 pack
48 attribute
48 attribute_lang
48 attribute_group
44 module
37 module_shop
35 category_product
25 an_wishlist
24 an_productextratabs_labels_relations
24 an_productextratabs_labels_lang
24 an_wishlist_products
24 product_attribute_lang
24 attribute_group_lang
24 attribute_shop
21 category
14 andropdown
14 andropdown_lang
11 category_group
10 hook
10 category_shop
10 manufacturer
10 cms
10 cms_shop
10 cms_lang
6 product_sale
6 smarty_lazy_cache
5 lang
5 country
5 currency
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 manufacturer_shop
4 manufacturer_lang
4 feature_value
4 layered_indexable_feature_value_lang_value
3 hook_alias
3 image_type
3 link_block
3 link_block_shop
2 shop_group
2 configuration
2 country_lang
2 country_shop
2 hook_module
2 currency_lang
2 group
2 group_shop
2 cart_rule_lang
2 smarty_last_flush
2 tax_rule
2 tax_rules_group
2 social_login_position
2 anmenu
2 anmenu_lang
2 link_block_lang
2 date_range
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 group_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 orders
1 hicookietype
1 hicookietype_lang
1 hicookietype_shop
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 dark_mode
1 an_trust_badges_widgets
1 an_trust_badges_widgets_lang
1 an_trust_badges_icons
1 connections
1 page_type
1 page
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 145 /classes/Link.php:113 (__construct) [id: 284]
/classes/Link.php:113 (__construct) [id: 285]
/classes/Link.php:113 (__construct) [id: 286]
/classes/Link.php:113 (__construct) [id: 287]
/classes/Link.php:113 (__construct) [id: 288]
/classes/Link.php:113 (__construct) [id: 289]
/classes/Link.php:113 (__construct) [id: 290]
/classes/Link.php:113 (__construct) [id: 291]
/classes/Link.php:113 (__construct) [id: 292]
/classes/Link.php:113 (__construct) [id: 293]
/classes/Link.php:113 (__construct) [id: 294]
/classes/Link.php:113 (__construct) [id: 295]
/classes/Link.php:113 (__construct) [id: 296]
/classes/Link.php:113 (__construct) [id: 297]
/classes/Link.php:113 (__construct) [id: 298]
/classes/Link.php:113 (__construct) [id: 299]
/classes/Link.php:113 (__construct) [id: 300]
/classes/Link.php:113 (__construct) [id: 301]
/classes/Link.php:113 (__construct) [id: 302]
/classes/Link.php:113 (__construct) [id: 303]
/classes/Link.php:113 (__construct) [id: 304]
/classes/Link.php:113 (__construct) [id: 305]
/classes/Link.php:113 (__construct) [id: 306]
/classes/Link.php:113 (__construct) [id: 307]
/modules/codwfeeplus/codwfeeplus.php:410 (__construct) [id: 12211]
/classes/Link.php:113 (__construct) [id: 10559]
/classes/Link.php:113 (__construct) [id: 1284]
/classes/Link.php:113 (__construct) [id: 1285]
/classes/Link.php:113 (__construct) [id: 8385]
/classes/Link.php:113 (__construct) [id: 8386]
/classes/Link.php:113 (__construct) [id: 8387]
/classes/Link.php:113 (__construct) [id: 8388]
/classes/Link.php:113 (__construct) [id: 8389]
/classes/Link.php:113 (__construct) [id: 8382]
/classes/Link.php:113 (__construct) [id: 8383]
/classes/Link.php:113 (__construct) [id: 1426]
/classes/Link.php:113 (__construct) [id: 2346]
/classes/Link.php:113 (__construct) [id: 2348]
/classes/Link.php:113 (__construct) [id: 2349]
/classes/Link.php:113 (__construct) [id: 3214]
/classes/Link.php:113 (__construct) [id: 3369]
/classes/Link.php:113 (__construct) [id: 3370]
/classes/Link.php:113 (__construct) [id: 3371]
/classes/Link.php:113 (__construct) [id: 3372]
/classes/Link.php:113 (__construct) [id: 3423]
/classes/Link.php:113 (__construct) [id: 3669]
/classes/Link.php:113 (__construct) [id: 4207]
/classes/Link.php:113 (__construct) [id: 4632]
/classes/Link.php:113 (__construct) [id: 4781]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10559]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1284]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1285]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8385]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8386]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8387]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8388]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8389]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8382]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 8383]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 1426]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2346]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2348]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 2349]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3214]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3369]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3370]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3371]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3372]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3423]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3669]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4207]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4632]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4781]
/classes/Link.php:113 (__construct) [id: 10559]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 10559]
/classes/Link.php:113 (__construct) [id: 10559]
/classes/Link.php:113 (__construct) [id: 1284]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1284]
/classes/Link.php:113 (__construct) [id: 1284]
/classes/Link.php:113 (__construct) [id: 1285]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1285]
/classes/Link.php:113 (__construct) [id: 1285]
/classes/Link.php:113 (__construct) [id: 8385]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8385]
/classes/Link.php:113 (__construct) [id: 8385]
/classes/Link.php:113 (__construct) [id: 8386]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8386]
/classes/Link.php:113 (__construct) [id: 8386]
/classes/Link.php:113 (__construct) [id: 8387]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8387]
/classes/Link.php:113 (__construct) [id: 8387]
/classes/Link.php:113 (__construct) [id: 8388]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8388]
/classes/Link.php:113 (__construct) [id: 8388]
/classes/Link.php:113 (__construct) [id: 8389]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8389]
/classes/Link.php:113 (__construct) [id: 8389]
/classes/Link.php:113 (__construct) [id: 8382]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8382]
/classes/Link.php:113 (__construct) [id: 8382]
/classes/Link.php:113 (__construct) [id: 8383]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 8383]
/classes/Link.php:113 (__construct) [id: 8383]
/classes/Link.php:113 (__construct) [id: 1426]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 1426]
/classes/Link.php:113 (__construct) [id: 1426]
/classes/Link.php:113 (__construct) [id: 2346]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 2346]
/classes/Link.php:113 (__construct) [id: 2346]
/classes/Link.php:113 (__construct) [id: 2348]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 2348]
/classes/Link.php:113 (__construct) [id: 2348]
/classes/Link.php:113 (__construct) [id: 2349]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 2349]
/classes/Link.php:113 (__construct) [id: 2349]
/classes/Link.php:113 (__construct) [id: 3214]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3214]
/classes/Link.php:113 (__construct) [id: 3214]
/classes/Link.php:113 (__construct) [id: 3369]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3369]
/classes/Link.php:113 (__construct) [id: 3369]
/classes/Link.php:113 (__construct) [id: 3370]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3370]
/classes/Link.php:113 (__construct) [id: 3370]
/classes/Link.php:113 (__construct) [id: 3371]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3371]
/classes/Link.php:113 (__construct) [id: 3371]
/classes/Link.php:113 (__construct) [id: 3372]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3372]
/classes/Link.php:113 (__construct) [id: 3372]
/classes/Link.php:113 (__construct) [id: 3423]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3423]
/classes/Link.php:113 (__construct) [id: 3423]
/classes/Link.php:113 (__construct) [id: 3669]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 3669]
/classes/Link.php:113 (__construct) [id: 3669]
/classes/Link.php:113 (__construct) [id: 4207]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4207]
/classes/Link.php:113 (__construct) [id: 4207]
/classes/Link.php:113 (__construct) [id: 4632]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4632]
/classes/Link.php:113 (__construct) [id: 4632]
/classes/Link.php:113 (__construct) [id: 4781]
/modules/an_productattributes/an_productattributes.php:277 (__construct) [id: 4781]
/classes/Link.php:113 (__construct) [id: 4781]
CMS 11 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 0]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 16]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 3]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 1]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 19]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 8]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 9]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 10]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 11]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 15]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:138 (__construct) [id: 23]
Category 11 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 11]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 88]
/controllers/front/listing/CategoryController.php:215 (__construct) [id: 90]
/classes/Meta.php:380 (__construct) [id: 11]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/facebookproductad/lib/pixel/pixelCategory.php:46 (__construct) [id: 11]
/modules/facebookproductad/lib/moduleTools.php:481 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 11]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 11]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 11]
Country 7 /config/config.inc.php:146 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1725 (__construct) [id: 10]
/modules/paypal/paypal.php:324 (__construct) [id: 10]
/modules/paypal/classes/AbstractMethodPaypal.php:90 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/modules/ps_contactinfo/ps_contactinfo.php:104 (__construct) [id: 10]
State 5 /classes/AddressFormat.php:404 (__construct) [id: 211]
/classes/controller/FrontController.php:1724 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:93 (__construct) [id: 211]
/classes/AddressFormat.php:404 (__construct) [id: 211]
/modules/ps_contactinfo/ps_contactinfo.php:103 (__construct) [id: 211]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3691 (initialize) [id: ]
/classes/Product.php:3801 (__construct) [id: ]
/classes/Product.php:5936 (__construct) [id: ]
Language 4 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:559 (__construct) [id: 1]
/modules/facebookproductad/lib/hook/hookDisplay.php:90 (__construct) [id: 1]
/modules/facebookproductad/lib/pixel/pixelCategory.php:39 (__construct) [id: 1]
Cart 4 /classes/controller/FrontController.php:429 (__construct) [id: ]
/classes/controller/FrontController.php:499 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
AddressFormat 2 /classes/controller/FrontController.php:1719 (generateAddress) [id: ]
/modules/ps_contactinfo/ps_contactinfo.php:98 (generateAddress) [id: ]
Carrier 2 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
PrestaShop\Module\LinkList\Model\LinkBlock 2 /modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 1]
/modules/ps_linklist/src/LegacyLinkBlockRepository.php:91 (__construct) [id: 6]
BoldizArt\DarkMode\Model\DarkModeOptionsModel 2 /modules/darkmode/darkmode.php:227 (__construct) [id: 1]
/modules/darkmode/darkmode.php:227 (__construct) [id: 1]
OrderState 2 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Currency 2 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:684 (getCurrencyInstance) [id: 1]
Hook 2 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
/modules/ps_linklist/src/Presenter/LinkBlockPresenter.php:64 (__construct) [id: 35]
Configuration 2 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
ImageType 1 /modules/an_brandslider/an_brandslider.php:440 (__construct) [id: 14]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Risk 1 /classes/controller/FrontController.php:1652 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1649 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/api-platform/core/src/deprecation.php
40 /vendor/api-platform/core/src/Api/FilterInterface.php
41 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
42 /vendor/api-platform/core/src/deprecated_interfaces.php
43 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
58 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
61 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
62 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
65 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
66 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
67 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
68 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
69 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
70 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
71 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
72 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
73 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
74 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
75 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
76 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
77 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
78 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
88 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
89 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
97 /vendor/psr/container/src/ContainerInterface.php
98 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
99 /vendor/ircmaxell/password-compat/lib/password.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /classes/Smarty/SmartyCustom.php
196 /vendor/smarty/smarty/libs/Smarty.class.php
197 /vendor/smarty/smarty/libs/functions.php
198 /vendor/smarty/smarty/libs/Autoloader.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
208 /config/smartyfront.config.inc.php
209 /classes/Smarty/SmartyResourceModule.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
212 /classes/Smarty/SmartyResourceParent.php
213 /classes/Smarty/SmartyLazyRegister.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
215 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
216 /classes/Customer.php
217 /classes/Group.php
218 /classes/Link.php
219 /classes/shop/ShopUrl.php
220 /classes/Dispatcher.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
228 /src/Adapter/SymfonyContainer.php
229 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
230 /config/db_slave_server.inc.php
231 /modules/anblog/anblog.php
232 /modules/anblog/loader.php
233 /modules/anblog/classes/config.php
234 /modules/anblog/config.php
235 /modules/anblog/libs/Helper.php
236 /modules/anblog/libs/AnblogImage.php
237 /modules/anblog/classes/anBlogLikes.php
238 /modules/anblog/classes/anblogcat.php
239 /modules/anblog/classes/blog.php
240 /modules/anblog/classes/link.php
241 /modules/anblog/classes/comment.php
242 /modules/anblog/classes/sitemap.php
243 /modules/anblog/classes/anBlogWidgets.php
244 /src/Core/Security/Hashing.php
245 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
246 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
247 /classes/Translate.php
248 /modules/anblog/translations/it.php
249 /src/PrestaShopBundle/Translation/TranslatorComponent.php
250 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
251 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
252 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
253 /vendor/symfony/contracts/Translation/TranslatorInterface.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
255 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
256 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
257 /src/PrestaShopBundle/Translation/TranslatorInterface.php
258 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
259 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
260 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
264 /vendor/symfony/contracts/Translation/TranslatorTrait.php
265 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
266 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
267 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
268 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
269 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
270 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
274 /override/controllers/front/listing/CategoryController.php
275 /controllers/front/listing/CategoryController.php
276 /classes/controller/ProductListingFrontController.php
277 /classes/controller/ProductPresentingFrontController.php
278 /classes/controller/FrontController.php
279 /src/Adapter/Presenter/Object/ObjectPresenter.php
280 /src/Adapter/Presenter/PresenterInterface.php
281 /src/Adapter/Presenter/Cart/CartPresenter.php
282 /src/Adapter/Product/PriceFormatter.php
283 /src/Adapter/Image/ImageRetriever.php
284 /classes/tax/TaxConfiguration.php
285 /classes/Smarty/TemplateFinder.php
286 /classes/assets/StylesheetManager.php
287 /classes/assets/AbstractAssetManager.php
288 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
289 /classes/assets/JavascriptManager.php
290 /classes/assets/CccReducer.php
291 /classes/Category.php
292 /classes/webservice/WebserviceRequest.php
293 /src/Adapter/ContainerBuilder.php
294 /src/Adapter/Environment.php
295 /src/Core/EnvironmentInterface.php
296 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
297 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
298 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
299 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
300 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
301 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
302 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
303 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
304 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
305 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
306 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
308 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
309 /vendor/symfony/contracts/Service/ResetInterface.php
310 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
311 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
312 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
313 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
314 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
315 /vendor/symfony/contracts/Cache/ItemInterface.php
316 /vendor/psr/cache/src/CacheItemInterface.php
317 /vendor/psr/cache/src/CacheItemPoolInterface.php
318 /vendor/symfony/contracts/Cache/CacheInterface.php
319 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
320 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
321 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
322 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
323 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
324 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
325 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
326 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
327 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
328 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
330 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
332 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
333 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
334 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
335 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
380 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
381 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
382 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
383 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
384 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
387 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
388 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
389 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
390 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
391 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
392 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
393 /var/cache/dev/FrontContainer.php
394 /src/Adapter/Container/LegacyContainer.php
395 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
396 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
397 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
399 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
400 /vendor/psr/container/src/ContainerExceptionInterface.php
401 /vendor/psr/container/src/NotFoundExceptionInterface.php
402 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
404 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
405 /src/Adapter/Container/LegacyContainerInterface.php
406 /modules/contactform/vendor/autoload.php
407 /modules/contactform/vendor/composer/autoload_real.php
408 /modules/contactform/vendor/composer/autoload_static.php
409 /modules/dashactivity/vendor/autoload.php
410 /modules/dashactivity/vendor/composer/autoload_real.php
411 /modules/dashactivity/vendor/composer/autoload_static.php
412 /modules/dashtrends/vendor/autoload.php
413 /modules/dashtrends/vendor/composer/autoload_real.php
414 /modules/dashtrends/vendor/composer/autoload_static.php
415 /modules/dashproducts/vendor/autoload.php
416 /modules/dashproducts/vendor/composer/autoload_real.php
417 /modules/dashproducts/vendor/composer/autoload_static.php
418 /modules/graphnvd3/vendor/autoload.php
419 /modules/graphnvd3/vendor/composer/autoload_real.php
420 /modules/graphnvd3/vendor/composer/autoload_static.php
421 /modules/gridhtml/vendor/autoload.php
422 /modules/gridhtml/vendor/composer/autoload_real.php
423 /modules/gridhtml/vendor/composer/autoload_static.php
424 /modules/ps_banner/vendor/autoload.php
425 /modules/ps_banner/vendor/composer/autoload_real.php
426 /modules/ps_banner/vendor/composer/platform_check.php
427 /modules/ps_banner/vendor/composer/autoload_static.php
428 /modules/ps_categorytree/vendor/autoload.php
429 /modules/ps_categorytree/vendor/composer/autoload_real.php
430 /modules/ps_categorytree/vendor/composer/platform_check.php
431 /modules/ps_categorytree/vendor/composer/autoload_static.php
432 /modules/ps_contactinfo/vendor/autoload.php
433 /modules/ps_contactinfo/vendor/composer/autoload_real.php
434 /modules/ps_contactinfo/vendor/composer/platform_check.php
435 /modules/ps_contactinfo/vendor/composer/autoload_static.php
436 /modules/ps_currencyselector/vendor/autoload.php
437 /modules/ps_currencyselector/vendor/composer/autoload_real.php
438 /modules/ps_currencyselector/vendor/composer/platform_check.php
439 /modules/ps_currencyselector/vendor/composer/autoload_static.php
440 /modules/ps_customeraccountlinks/vendor/autoload.php
441 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
442 /modules/ps_customeraccountlinks/vendor/composer/platform_check.php
443 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
444 /modules/ps_customersignin/vendor/autoload.php
445 /modules/ps_customersignin/vendor/composer/autoload_real.php
446 /modules/ps_customersignin/vendor/composer/platform_check.php
447 /modules/ps_customersignin/vendor/composer/autoload_static.php
448 /modules/ps_customtext/vendor/autoload.php
449 /modules/ps_customtext/vendor/composer/autoload_real.php
450 /modules/ps_customtext/vendor/composer/platform_check.php
451 /modules/ps_customtext/vendor/composer/autoload_static.php
452 /modules/ps_emailsubscription/vendor/autoload.php
453 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
454 /modules/ps_emailsubscription/vendor/composer/platform_check.php
455 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
456 /modules/ps_faviconnotificationbo/vendor/autoload.php
457 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
458 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
459 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
460 /modules/ps_featuredproducts/vendor/autoload.php
461 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
462 /modules/ps_featuredproducts/vendor/composer/platform_check.php
463 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
464 /modules/ps_languageselector/vendor/autoload.php
465 /modules/ps_languageselector/vendor/composer/autoload_real.php
466 /modules/ps_languageselector/vendor/composer/platform_check.php
467 /modules/ps_languageselector/vendor/composer/autoload_static.php
468 /modules/ps_linklist/vendor/autoload.php
469 /modules/ps_linklist/vendor/composer/autoload_real.php
470 /modules/ps_linklist/vendor/composer/platform_check.php
471 /modules/ps_linklist/vendor/composer/autoload_static.php
472 /modules/ps_mainmenu/vendor/autoload.php
473 /modules/ps_mainmenu/vendor/composer/autoload_real.php
474 /modules/ps_mainmenu/vendor/composer/platform_check.php
475 /modules/ps_mainmenu/vendor/composer/autoload_static.php
476 /modules/ps_searchbar/vendor/autoload.php
477 /modules/ps_searchbar/vendor/composer/autoload_real.php
478 /modules/ps_searchbar/vendor/composer/platform_check.php
479 /modules/ps_searchbar/vendor/composer/autoload_static.php
480 /modules/ps_sharebuttons/vendor/autoload.php
481 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
482 /modules/ps_sharebuttons/vendor/composer/platform_check.php
483 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
484 /modules/ps_shoppingcart/vendor/autoload.php
485 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
486 /modules/ps_shoppingcart/vendor/composer/platform_check.php
487 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
488 /modules/ps_socialfollow/vendor/autoload.php
489 /modules/ps_socialfollow/vendor/composer/autoload_real.php
490 /modules/ps_socialfollow/vendor/composer/platform_check.php
491 /modules/ps_socialfollow/vendor/composer/autoload_static.php
492 /modules/ps_themecusto/vendor/autoload.php
493 /modules/ps_themecusto/vendor/composer/autoload_real.php
494 /modules/ps_themecusto/vendor/composer/platform_check.php
495 /modules/ps_themecusto/vendor/composer/autoload_static.php
496 /modules/pagesnotfound/vendor/autoload.php
497 /modules/pagesnotfound/vendor/composer/autoload_real.php
498 /modules/pagesnotfound/vendor/composer/autoload_static.php
499 /modules/psgdpr/vendor/autoload.php
500 /modules/psgdpr/vendor/composer/autoload_real.php
501 /modules/psgdpr/vendor/composer/autoload_static.php
502 /modules/ps_facetedsearch/vendor/autoload.php
503 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
504 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
505 /modules/ps_categoryproducts/vendor/autoload.php
506 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
507 /modules/ps_categoryproducts/vendor/composer/platform_check.php
508 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
509 /modules/ps_viewedproduct/vendor/autoload.php
510 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
511 /modules/ps_viewedproduct/vendor/composer/platform_check.php
512 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
513 /modules/ps_crossselling/vendor/autoload.php
514 /modules/ps_crossselling/vendor/composer/autoload_real.php
515 /modules/ps_crossselling/vendor/composer/platform_check.php
516 /modules/ps_crossselling/vendor/composer/autoload_static.php
517 /modules/ps_bestsellers/vendor/autoload.php
518 /modules/ps_bestsellers/vendor/composer/autoload_real.php
519 /modules/ps_bestsellers/vendor/composer/platform_check.php
520 /modules/ps_bestsellers/vendor/composer/autoload_static.php
521 /modules/ps_dataprivacy/vendor/autoload.php
522 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
523 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
524 /modules/sociallogin/vendor/autoload.php
525 /modules/sociallogin/vendor/composer/autoload_real.php
526 /modules/sociallogin/vendor/composer/autoload_static.php
527 /modules/sociallogin/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
528 /modules/eicaptcha/vendor/autoload.php
529 /modules/eicaptcha/vendor/composer/autoload_real.php
530 /modules/eicaptcha/vendor/composer/platform_check.php
531 /modules/eicaptcha/vendor/composer/autoload_static.php
532 /modules/eicaptcha/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
533 /modules/eicaptcha/vendor/symfony/string/Resources/functions.php
534 /modules/paypal/vendor/autoload.php
535 /modules/paypal/vendor/composer/autoload_real.php
536 /modules/paypal/vendor/composer/autoload_static.php
537 /modules/paypal/vendor/paragonie/random_compat/lib/random.php
538 /modules/paypal/vendor/symfony/polyfill-php70/bootstrap.php
539 /modules/paypal/vendor/guzzlehttp/psr7/src/functions_include.php
540 /modules/paypal/vendor/guzzlehttp/psr7/src/functions.php
541 /modules/ps_emailalerts/vendor/autoload.php
542 /modules/ps_emailalerts/vendor/composer/autoload_real.php
543 /modules/ps_emailalerts/vendor/composer/platform_check.php
544 /modules/ps_emailalerts/vendor/composer/autoload_static.php
545 /modules/darkmode/vendor/autoload.php
546 /modules/darkmode/vendor/composer/autoload_real.php
547 /modules/darkmode/vendor/composer/platform_check.php
548 /modules/darkmode/vendor/composer/autoload_static.php
549 /modules/payplug/vendor/autoload.php
550 /modules/payplug/vendor/composer/autoload_real.php
551 /modules/payplug/vendor/composer/autoload_static.php
552 /modules/app_endpoint/vendor/autoload.php
553 /modules/app_endpoint/vendor/composer/autoload_real.php
554 /modules/app_endpoint/vendor/composer/platform_check.php
555 /modules/app_endpoint/vendor/composer/autoload_static.php
556 /modules/autoupgrade/vendor/autoload.php
557 /modules/autoupgrade/vendor/composer/autoload_real.php
558 /modules/autoupgrade/vendor/composer/autoload_static.php
559 /modules/ps_specials/vendor/autoload.php
560 /modules/ps_specials/vendor/composer/autoload_real.php
561 /modules/ps_specials/vendor/composer/autoload_static.php
562 /modules/mangayo_assistant/vendor/autoload.php
563 /modules/mangayo_assistant/vendor/composer/autoload_real.php
564 /modules/mangayo_assistant/vendor/composer/autoload_static.php
565 /src/Core/Localization/Locale/Repository.php
566 /src/Core/Localization/Locale/RepositoryInterface.php
567 /src/Core/Localization/CLDR/LocaleRepository.php
568 /src/Core/Localization/CLDR/LocaleDataSource.php
569 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
570 /src/Core/Data/Layer/AbstractDataLayer.php
571 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
572 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
573 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
574 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
575 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
576 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
577 /vendor/symfony/contracts/Cache/CacheTrait.php
578 /vendor/psr/cache/src/InvalidArgumentException.php
579 /vendor/psr/cache/src/CacheException.php
580 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
581 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
582 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
583 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
584 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
585 /src/Core/Localization/CLDR/Reader.php
586 /src/Core/Localization/CLDR/ReaderInterface.php
587 /src/Core/Localization/Currency/Repository.php
588 /src/Core/Localization/Currency/RepositoryInterface.php
589 /src/Core/Localization/Currency/CurrencyDataSource.php
590 /src/Core/Localization/Currency/DataSourceInterface.php
591 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
592 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
593 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
594 /src/Adapter/Currency/CurrencyDataProvider.php
595 /src/Core/Currency/CurrencyDataProviderInterface.php
596 /src/Adapter/LegacyContext.php
597 /src/Adapter/Tools.php
598 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
599 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
600 /vendor/prestashop/decimal/src/Operation/Rounding.php
601 /src/Core/Localization/Locale.php
602 /src/Core/Localization/LocaleInterface.php
603 /src/Core/Localization/Specification/Price.php
604 /src/Core/Localization/Specification/Number.php
605 /src/Core/Localization/Specification/NumberInterface.php
606 /src/Core/Localization/Specification/Factory.php
607 /src/Core/Localization/CLDR/LocaleData.php
608 /src/Core/Localization/CLDR/NumberSymbolsData.php
609 /src/Core/Localization/CLDR/CurrencyData.php
610 /src/Core/Localization/CLDR/Locale.php
611 /src/Core/Localization/CLDR/LocaleInterface.php
612 /src/Core/Localization/Specification/NumberSymbolList.php
613 /classes/Currency.php
614 /src/Core/Localization/Currency/LocalizedCurrencyId.php
615 /src/Core/Localization/Currency/CurrencyData.php
616 /src/Core/Localization/Currency/CurrencyCollection.php
617 /src/Core/Localization/Currency.php
618 /src/Core/Localization/CurrencyInterface.php
619 /src/Core/Localization/Specification/NumberCollection.php
620 /src/Core/Localization/Number/Formatter.php
621 /classes/Cart.php
622 /src/Adapter/AddressFactory.php
623 /classes/CartRule.php
624 /classes/Product.php
625 /src/Core/Domain/Product/ValueObject/RedirectType.php
626 /src/Core/Util/DateTime/DateTime.php
627 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
628 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
629 /src/Core/Domain/Product/ValueObject/ProductType.php
630 /src/Core/Domain/Product/ValueObject/Reference.php
631 /src/Core/Domain/Product/ValueObject/Ean13.php
632 /src/Core/Domain/Product/ValueObject/Isbn.php
633 /src/Core/Domain/Product/ValueObject/Upc.php
634 /src/Core/Domain/Product/ProductSettings.php
635 /src/Core/Domain/Shop/ValueObject/ShopId.php
636 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
637 /modules/ps_emailsubscription/ps_emailsubscription.php
638 /src/Core/Module/WidgetInterface.php
639 /src/PrestaShopBundle/Translation/DomainNormalizer.php
640 /classes/Media.php
641 /modules/ps_socialfollow/ps_socialfollow.php
642 /modules/ps_emailalerts/ps_emailalerts.php
643 /modules/ps_emailalerts/MailAlert.php
644 /classes/ProductDownload.php
645 /classes/tax/Tax.php
646 /src/Core/Localization/CLDR/ComputingPrecision.php
647 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
648 /src/Core/Cart/Calculator.php
649 /src/Core/Cart/CartRowCollection.php
650 /src/Core/Cart/Fees.php
651 /src/Core/Cart/AmountImmutable.php
652 /src/Core/Cart/CartRuleCollection.php
653 /src/Core/Cart/CartRuleCalculator.php
654 /src/Adapter/Product/PriceCalculator.php
655 /classes/order/Order.php
656 /src/Core/Cart/CartRow.php
657 /vendor/prestashop/decimal/src/DecimalNumber.php
658 /vendor/prestashop/decimal/src/Builder.php
659 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
660 /classes/Gender.php
661 /classes/Risk.php
662 /classes/Meta.php
663 /classes/Address.php
664 /classes/ImageType.php
665 /classes/State.php
666 /src/Core/Security/PasswordPolicyConfiguration.php
667 /src/Core/Configuration/DataConfigurationInterface.php
668 /src/Core/Filter/FrontEndObject/MainFilter.php
669 /src/Core/Filter/FilterInterface.php
670 /src/Core/Filter/FrontEndObject/CartFilter.php
671 /src/Core/Filter/HashMapWhitelistFilter.php
672 /src/Core/Filter/CollectionFilter.php
673 /src/Core/Filter/FrontEndObject/ProductFilter.php
674 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
675 /src/Core/Filter/FrontEndObject/CustomerFilter.php
676 /src/Core/Filter/FrontEndObject/ShopFilter.php
677 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
678 /modules/ps_shoppingcart/ps_shoppingcart.php
679 /modules/ets_crosssell/ets_crosssell.php
680 /modules/ets_crosssell/Ets_crosssell_db.php
681 /modules/ets_crosssell/translations/it.php
682 /classes/Manufacturer.php
683 /src/Core/Util/String/StringModifier.php
684 /src/Core/Util/String/StringModifierInterface.php
685 /modules/ps_searchbar/ps_searchbar.php
686 /modules/an_productextratabs/an_productextratabs.php
687 /modules/an_productextratabs/classes/anTabsCombinations.php
688 /modules/an_productextratabs/classes/anProductTabs.php
689 /modules/an_productextratabs/classes/anProductTabsTplContent.php
690 /modules/an_productextratabs/classes/anProductTabsLabels.php
691 /modules/an_productextratabs/translations/it.php
692 /modules/an_client_service/an_client_service.php
693 /modules/an_client_service/translations/it.php
694 /modules/an_trust_badges/an_trust_badges.php
695 /modules/an_trust_badges/classes/AnTrustBadgesWidgets.php
696 /modules/an_trust_badges/classes/AnTrustBadgesIcons.php
697 /modules/an_trust_badges/translations/it.php
698 /modules/an_user_testimonials/an_user_testimonials.php
699 /modules/an_user_testimonials/classes/AnUserTestimonials.php
700 /modules/an_user_testimonials/translations/it.php
701 /modules/an_accordion/an_accordion.php
702 /modules/an_accordion/classes/AnAccordionBlock.php
703 /modules/an_accordion/translations/it.php
704 /modules/an_homeslider/an_homeslider.php
705 /modules/an_homeslider/classes/anHomeSliderFiles.php
706 /modules/an_homeslider/classes/anHomeSlides.php
707 /modules/an_homeslider/classes/anHomeSliders.php
708 /modules/an_homeslider/hooks_ignore.php
709 /modules/an_homeslider/translations/it.php
710 /modules/an_homeproducts/an_homeproducts.php
711 /modules/an_homeproducts/classes/anHomeProductsBlocks.php
712 /modules/an_homeproducts/classes/anHomeProductFiles.php
713 /modules/an_homeproducts/classes/anHomeProductsBanners.php
714 /modules/an_homeproducts/translations/it.php
715 /modules/an_banners/an_banners.php
716 /modules/an_banners/classes/anBanners.php
717 /modules/an_banners/hooks_ignore.php
718 /modules/an_banners/translations/it.php
719 /modules/an_simplefreeshippingline/an_simplefreeshippingline.php
720 /modules/an_simplefreeshippingline/translations/it.php
721 /modules/an_homecategories/an_homecategories.php
722 /modules/an_homecategories/classes/anHomecatFiles.php
723 /modules/an_homecategories/classes/AnHomecategories.php
724 /modules/an_homecategories/translations/it.php
725 /modules/paypal/paypal.php
726 /modules/paypal/config_prod.php
727 /classes/PaymentModule.php
728 /modules/paypal/classes/Shortcut/ShortcutConfiguration.php
729 /modules/paypal/smarty/plugins/modifier.paypalreplace.php
730 /modules/paypal/translations/it.php
731 /modules/paypal/classes/Constants/PaypalConfigurations.php
732 /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php
733 /modules/paypal/classes/Constants/WebHookConf.php
734 /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php
735 /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php
736 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php
737 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php
738 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php
739 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php
740 /modules/paypal/diagnostic.php
741 /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php
742 /modules/paypal/classes/AbstractMethodPaypal.php
743 /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php
744 /modules/paypal/classes/MethodEC.php
745 /modules/paypal/classes/WhiteList/WhiteListService.php
746 /modules/paypal/classes/API/PaypalApiManager.php
747 /modules/paypal/classes/API/PaypalApiManagerInterface.php
748 /modules/paypal/classes/API/PaypalVaultApiManagerInterface.php
749 /modules/paypal/classes/API/PaypalClient.php
750 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalHttpClient.php
751 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/HttpClient.php
752 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/ProductionEnvironment.php
753 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalEnvironment.php
754 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Environment.php
755 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Encoder.php
756 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Json.php
757 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer.php
758 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Text.php
759 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Multipart.php
760 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Form.php
761 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/AuthorizationInjector.php
762 /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Injector.php
763 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/GzipInjector.php
764 /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/FPTIInstrumentationInjector.php
765 /classes/Smarty/SmartyCustomTemplate.php
766 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
767 /var/cache/dev/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php
768 /modules/anscrolltop/anscrolltop.php
769 /modules/anscrolltop/translations/it.php
770 /modules/darkmode/darkmode.php
771 /src/Adapter/Localization/LegacyTranslator.php
772 /modules/darkmode/translations/it.php
773 /modules/eicaptcha/eicaptcha.php
774 /modules/eicaptcha/translations/it.php
775 /modules/eicaptcha/src/Debugger.php
776 /modules/mangayo_assistant/mangayo_assistant.php
777 /modules/mangayo_assistant/translations/it.php
778 /modules/facebookproductad/facebookproductad.php
779 /modules/facebookproductad/vendor/autoload.php
780 /modules/facebookproductad/vendor/composer/autoload_real.php
781 /modules/facebookproductad/vendor/composer/platform_check.php
782 /modules/facebookproductad/vendor/composer/autoload_static.php
783 /modules/facebookproductad/translations/it.php
784 /modules/facebookproductad/lib/moduleTools.php
785 /modules/facebookproductad/conf/moduleConfiguration.php
786 /modules/facebookproductad/lib/hook/hookController.php
787 /modules/facebookproductad/lib/hook/hookDisplay.php
788 /modules/facebookproductad/lib/hook/hookBase.php
789 /modules/facebookproductad/lib/dao/moduleDao.php
790 /modules/facebookproductad/lib/pixel/basePixel.php
791 /modules/facebookproductad/lib/pixel/pixelCategory.php
792 /classes/Combination.php
793 /classes/stock/StockAvailable.php
794 /classes/SpecificPrice.php
795 /classes/tax/TaxManagerFactory.php
796 /classes/tax/TaxRulesTaxManager.php
797 /classes/tax/TaxManagerInterface.php
798 /classes/tax/TaxCalculator.php
799 /classes/GroupReduction.php
800 /classes/Pack.php
801 /classes/Feature.php
802 /var/cache/dev/smarty/compile/charme/b3/c8/1a/b3c81a5ca82982e30cc717b20aaf37611d4de76f_2.file.header.tpl.php
803 /modules/an_brandslider/an_brandslider.php
804 /modules/an_brandslider/translations/it.php
805 /modules/an_megamenu/an_megamenu.php
806 /modules/an_megamenu/classes/AnMenu.php
807 /modules/an_megamenu/classes/AnDropdown.php
808 /classes/controller/AdminController.php
809 /modules/an_megamenu/composite/AnMegaMenuConfigurator.php
810 /modules/an_megamenu/composite/AnMegaMenuMenuConfigurator.php
811 /modules/an_megamenu/composite/AnMegaMenuHooks.php
812 /modules/an_megamenu/composite/AnMegaMenuAjaxHandler.php
813 /modules/an_megamenu/composite/AnMegaMenuDropDownConfigurator.php
814 /modules/an_productattributes/an_productattributes.php
815 /modules/an_productattributes/classes/anProductAttr.php
816 /modules/an_productattributes/translations/it.php
817 /var/cache/dev/smarty/compile/charme/ed/2e/b6/ed2eb6a7d481b95124e291b11541581f4431489e_2.file.js_header.tpl.php
818 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
819 /modules/an_wishlist/an_wishlist.php
820 /modules/an_wishlist/classes/an_wish.php
821 /modules/an_wishlist/classes/an_wish_products.php
822 /modules/an_wishlist/classes/an_wishListing.php
823 /modules/an_wishlist/translations/it.php
824 /modules/an_stickyaddtocart/an_stickyaddtocart.php
825 /modules/an_stickyaddtocart/translations/it.php
826 /modules/an_theme/an_theme.php
827 /modules/an_theme/classes/InputFactory.php
828 /modules/an_theme/classes/Input.php
829 /modules/an_theme/classes/Validation.php
830 /modules/an_theme/classes/antheme.php
831 /modules/an_theme/classes/anThemeFiles.php
832 /modules/an_theme/translations/it.php
833 /themes/charme/assets/antheme/config/theme_fonts.php
834 /themes/charme/assets/antheme/config/theme_js.php
835 /themes/charme/assets/antheme/config/theme_css.php
836 /themes/charme/assets/antheme/config/vars.php
837 /themes/charme/assets/antheme/config/fields.php
838 /modules/sociallogin/sociallogin.php
839 /modules/sociallogin/translations/it.php
840 /modules/ps_googleanalytics/ps_googleanalytics.php
841 /modules/ps_googleanalytics/vendor/autoload.php
842 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
843 /modules/ps_googleanalytics/vendor/composer/platform_check.php
844 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
845 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
846 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
847 /var/cache/dev/smarty/compile/charme/d2/a4/03/d2a40332993e3600f818db0d45a227f1af331e1a_2.file.ps_googleanalytics.tpl.php
848 /modules/luminage_mail/luminage_mail.php
849 /modules/luminage_mail/translations/it.php
850 /modules/hioutofstocknotification/hioutofstocknotification.php
851 /modules/hioutofstocknotification/classes/HiPrestaModule.php
852 /modules/hioutofstocknotification/classes/outofstock.php
853 /modules/hioutofstocknotification/classes/sentemail.php
854 /modules/hioutofstocknotification/classes/statistic.php
855 /modules/hioutofstocknotification/classes/oosnpdf.php
856 /classes/pdf/HTMLTemplate.php
857 /modules/hioutofstocknotification/classes/adminForms.php
858 /modules/hioutofstocknotification/translations/it.php
859 /var/cache/dev/smarty/compile/charme/b2/c3/47/b2c3472b487ed27b1e317c435a1d8b7f737453cb_2.file.header.tpl.php
860 /modules/ambjolisearch/ambjolisearch.php
861 /modules/ambjolisearch/classes/AmbJolisearchModule.php
862 /modules/ambjolisearch/classes/AmbIndexation.php
863 /modules/ambjolisearch/classes/AmbSearch.php
864 /modules/ambjolisearch/classes/definitions.php
865 /modules/ambjolisearch/classes/JoliLink.php
866 /modules/ambjolisearch/classes/JoliLink-1.7.php
867 /modules/ambjolisearch/classes/AmbJolisearchModuleProxy.php
868 /modules/ambjolisearch/translations/it.php
869 /modules/hicookielaw/hicookielaw.php
870 /modules/hicookielaw/classes/HiPrestaModule.php
871 /modules/hicookielaw/classes/adminForms.php
872 /modules/hicookielaw/classes/consent.php
873 /modules/hicookielaw/classes/type.php
874 /modules/hicookielaw/translations/it.php
875 /var/cache/dev/smarty/compile/charme/0c/8b/7b/0c8b7bc449184adb2e93a99131724c331ff4e737_2.file.header.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
877 /modules/payplug/payplug.php
878 /modules/payplug/translations/it.php
879 /modules/payplug/classes/PayPlugDependencies.php
880 /modules/payplug/classes/DependenciesClass.php
881 /modules/payplug/src/utilities/validators/accountValidator.php
882 /modules/payplug/src/utilities/validators/browserValidator.php
883 /modules/payplug/src/utilities/validators/cardValidator.php
884 /modules/payplug/src/utilities/validators/lockValidator.php
885 /modules/payplug/src/utilities/validators/loggerValidator.php
886 /modules/payplug/src/utilities/validators/moduleValidator.php
887 /modules/payplug/src/utilities/validators/orderValidator.php
888 /modules/payplug/src/utilities/validators/paymentValidator.php
889 /modules/payplug/src/utilities/helpers/AmountHelper.php
890 /modules/payplug/src/utilities/helpers/CookiesHelper.php
891 /modules/payplug/src/utilities/helpers/FilesHelper.php
892 /modules/payplug/src/utilities/helpers/PhoneHelper.php
893 /modules/payplug/src/utilities/helpers/UserHelper.php
894 /modules/payplug/src/application/dependencies/PluginInit.php
895 /modules/payplug/src/application/dependencies/BaseClass.php
896 /modules/payplug/src/actions/CardAction.php
897 /modules/payplug/src/actions/ConfigurationAction.php
898 /modules/payplug/src/actions/MerchantTelemetryAction.php
899 /modules/payplug/src/actions/OnboardingAction.php
900 /modules/payplug/src/actions/OrderStateAction.php
901 /modules/payplug/src/actions/PaymentAction.php
902 /modules/payplug/src/models/entities/CacheEntity.php
903 /modules/payplug/src/models/entities/OneyEntity.php
904 /modules/payplug/src/models/entities/PluginEntity.php
905 /modules/payplug/src/models/entities/OrderStateEntity.php
906 /modules/payplug/src/application/adapter/AddressAdapter.php
907 /modules/payplug/src/interfaces/AddressInterface.php
908 /modules/payplug/src/application/adapter/AssignAdapter.php
909 /modules/payplug/src/interfaces/AssignInterface.php
910 /modules/payplug/src/application/adapter/CarrierAdapter.php
911 /modules/payplug/src/interfaces/CarrierInterface.php
912 /classes/Carrier.php
913 /modules/payplug/src/application/adapter/CartAdapter.php
914 /modules/payplug/src/interfaces/CartInterface.php
915 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
916 /modules/payplug/src/interfaces/ConfigurationInterface.php
917 /modules/payplug/src/application/adapter/ConstantAdapter.php
918 /modules/payplug/src/interfaces/ConstantInterface.php
919 /modules/payplug/src/application/adapter/ContextAdapter.php
920 /modules/payplug/src/interfaces/ContextInterface.php
921 /modules/payplug/src/application/adapter/CountryAdapter.php
922 /modules/payplug/src/interfaces/CountryInterface.php
923 /modules/payplug/src/application/adapter/CurrencyAdapter.php
924 /modules/payplug/src/interfaces/CurrencyInterface.php
925 /modules/payplug/src/application/adapter/CustomerAdapter.php
926 /modules/payplug/src/interfaces/CustomerInterface.php
927 /modules/payplug/src/application/adapter/DispatcherAdapter.php
928 /modules/payplug/src/interfaces/DispatcherInterface.php
929 /modules/payplug/src/application/adapter/LanguageAdapter.php
930 /modules/payplug/src/interfaces/LanguageInterface.php
931 /modules/payplug/src/application/adapter/MediaAdapter.php
932 /modules/payplug/src/interfaces/MediaInterface.php
933 /modules/payplug/src/application/adapter/MessageAdapter.php
934 /modules/payplug/src/interfaces/MessageInterface.php
935 /modules/payplug/src/application/adapter/ModuleAdapter.php
936 /modules/payplug/src/interfaces/ModuleInterface.php
937 /modules/payplug/src/application/adapter/OrderAdapter.php
938 /modules/payplug/src/interfaces/OrderInterface.php
939 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
940 /modules/payplug/src/interfaces/OrderHistoryInterface.php
941 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
942 /modules/payplug/src/interfaces/OrderSlipInterface.php
943 /modules/payplug/src/application/adapter/OrderStateAdapter.php
944 /modules/payplug/src/interfaces/OrderStateInterface.php
945 /classes/order/OrderState.php
946 /modules/payplug/src/application/adapter/ProductAdapter.php
947 /modules/payplug/src/interfaces/ProductInterface.php
948 /modules/payplug/src/application/adapter/QueryAdapter.php
949 /modules/payplug/src/interfaces/QueryInterface.php
950 /modules/payplug/src/application/adapter/ShopAdapter.php
951 /modules/payplug/src/interfaces/ShopInterface.php
952 /modules/payplug/src/application/adapter/ToolsAdapter.php
953 /modules/payplug/src/interfaces/ToolsInterface.php
954 /modules/payplug/src/application/adapter/TranslationAdapter.php
955 /modules/payplug/src/interfaces/TranslationInterface.php
956 /modules/payplug/src/application/adapter/ValidateAdapter.php
957 /modules/payplug/src/interfaces/ValidateInterface.php
958 /modules/payplug/src/models/classes/ApiRest.php
959 /modules/payplug/src/models/classes/Configuration.php
960 /modules/payplug/src/models/classes/Country.php
961 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
962 /modules/payplug/src/models/classes/Translation.php
963 /modules/payplug/translations/en.php
964 /modules/payplug/src/models/repositories/CardRepository.php
965 /modules/payplug/src/models/repositories/QueryRepository.php
966 /modules/payplug/src/models/repositories/CacheRepository.php
967 /modules/payplug/src/models/repositories/CountryRepository.php
968 /modules/payplug/src/models/repositories/LockRepository.php
969 /modules/payplug/src/models/repositories/LoggerRepository.php
970 /modules/payplug/src/models/repositories/ModuleRepository.php
971 /modules/payplug/src/models/repositories/OrderRepository.php
972 /modules/payplug/src/models/repositories/OrderStateRepository.php
973 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
974 /modules/payplug/src/models/repositories/PaymentRepository.php
975 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
976 /modules/payplug/src/models/repositories/ShopRepository.php
977 /modules/payplug/classes/MyLogPHP.php
978 /modules/payplug/src/repositories/LoggerRepository.php
979 /modules/payplug/src/models/entities/LoggerEntity.php
980 /modules/payplug/src/repositories/TranslationsRepository.php
981 /modules/payplug/src/repositories/SQLtableRepository.php
982 /modules/payplug/src/repositories/CacheRepository.php
983 /modules/payplug/src/repositories/OneyRepository.php
984 /modules/payplug/src/repositories/OrderStateRepository.php
985 /modules/payplug/src/repositories/InstallRepository.php
986 /modules/payplug/src/utilities/services/Browser.php
987 /modules/payplug/src/utilities/services/Routes.php
988 /modules/payplug/src/utilities/services/MerchantTelemetry.php
989 /modules/payplug/classes/ApiClass.php
990 /modules/payplug/classes/ApplePayClass.php
991 /modules/payplug/classes/AmountCurrencyClass.php
992 /modules/payplug/classes/AdminClass.php
993 /modules/payplug/classes/PayplugLock.php
994 /modules/payplug/classes/CartClass.php
995 /modules/payplug/classes/ConfigClass.php
996 /modules/payplug/classes/InstallmentClass.php
997 /modules/payplug/classes/HookClass.php
998 /modules/payplug/classes/MediaClass.php
999 /modules/payplug/classes/OrderClass.php
1000 /modules/payplug/classes/PaymentClass.php
1001 /modules/payplug/classes/RefundClass.php
1002 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1003 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1004 /var/cache/dev/smarty/compile/charme/6a/fd/5e/6afd5effcf983f0813cac21afbfc06523d64a8ee_2.file.messages.tpl.php
1005 /modules/app_endpoint/app_endpoint.php
1006 /modules/app_endpoint/translations/it.php
1007 /modules/codwfeeplus/codwfeeplus.php
1008 /modules/codwfeeplus/CODwFP.php
1009 /modules/codwfeeplus/translations/it.php
1010 /src/Core/Product/Search/ProductSearchContext.php
1011 /src/Core/Product/Search/ProductSearchQuery.php
1012 /src/Core/Product/Search/SortOrder.php
1013 /modules/ps_facetedsearch/ps_facetedsearch.php
1014 /modules/ps_facetedsearch/src/HookDispatcher.php
1015 /modules/ps_facetedsearch/src/Hook/Attribute.php
1016 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1017 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1018 /modules/ps_facetedsearch/src/Hook/Category.php
1019 /modules/ps_facetedsearch/src/Hook/Configuration.php
1020 /modules/ps_facetedsearch/src/Hook/Design.php
1021 /modules/ps_facetedsearch/src/Hook/Feature.php
1022 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1023 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1024 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1025 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1026 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1027 /modules/ps_facetedsearch/src/Hook/Product.php
1028 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1029 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1030 /modules/ps_facetedsearch/src/Filters/Provider.php
1031 /modules/ps_facetedsearch/src/URLSerializer.php
1032 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1033 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1034 /src/Core/Product/Search/FacetsRendererInterface.php
1035 /src/Core/Product/Search/ProductSearchProviderInterface.php
1036 /modules/ps_facetedsearch/src/Filters/Converter.php
1037 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1038 /modules/ambjolisearch/src/Amb_ProductSearchProvider.php
1039 /src/Core/Product/Search/ProductSearchResult.php
1040 /modules/ps_facetedsearch/src/Product/Search.php
1041 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1042 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1043 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1044 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1045 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1046 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1047 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1048 /modules/ps_facetedsearch/src/Filters/Products.php
1049 /modules/ps_facetedsearch/src/Filters/Block.php
1050 /src/Core/Product/Search/Facet.php
1051 /src/Core/Product/Search/Filter.php
1052 /src/Core/Product/Search/FacetCollection.php
1053 /classes/ProductAssembler.php
1054 /classes/ProductPresenterFactory.php
1055 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1056 /src/Adapter/Presenter/Product/ProductPresenter.php
1057 /src/Adapter/Product/ProductColorsRetriever.php
1058 /src/Adapter/HookManager.php
1059 /src/Core/Product/ProductPresentationSettings.php
1060 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1061 /src/Adapter/Presenter/Product/ProductLazyArray.php
1062 /src/Adapter/Presenter/AbstractLazyArray.php
1063 /classes/Image.php
1064 /src/Core/Image/ImageFormatConfiguration.php
1065 /src/Core/Image/ImageFormatConfigurationInterface.php
1066 /classes/FeatureFlag.php
1067 /src/Core/FeatureFlag/FeatureFlagSettings.php
1068 /vendor/prestashop/decimal/src/Operation/Multiplication.php
1069 /vendor/prestashop/decimal/src/Operation/Addition.php
1070 /src/Core/Util/Inflector.php
1071 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1072 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1073 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1074 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1075 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1076 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1077 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1078 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1079 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1080 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1081 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1082 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1083 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1084 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1085 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1086 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1087 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1088 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1089 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1090 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1091 /var/cache/dev/smarty/compile/charme/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1092 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1093 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1094 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1095 /var/cache/dev/smarty/compile/charme/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1096 /src/Core/Product/Search/Pagination.php
1097 /modules/sociallogin/models/SocialLoginPosition.php
1098 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/66/81/f1/6681f1287ad4751f4330999bf7e5047ef3e52cec_2.file.category.tpl.php
1099 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ee/8c/21/ee8c21f25c301be5b9dae26ba3672f4427c6aeb2_2.file.product-list.tpl.php
1100 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/c1/e5/02/c1e502525a49748091427e0df780f90846bd9d90_2.file.layout-left-column.tpl.php
1101 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a2/43/0d/a2430dfc6da9bb5b779a9919d46af9cb98017def_2.file.layout-both-columns.tpl.php
1102 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a0/b9/f1/a0b9f11bc34eb90e03108a3780da705e4c424c76_2.file.head.tpl.php
1103 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5c/99/24/5c9924d502b61764c40eeba7cd7dda269692307d_2.file.stylesheets.tpl.php
1104 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/3b/3c/ff/3b3cff40db7c22a4ee30c69b5f51819b85be6d9c_2.file.preload.tpl.php
1105 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/ad/54/e6/ad54e66984a22371c20ef3cde2b3e98bd215d8e8_2.file.javascript.tpl.php
1106 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/fd/59/0a/fd590a6b567acb629cd24ef142a6acc3994b20dd_2.file.product-activation.tpl.php
1107 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/6b/40/6a/6b406af67655c04b1b8bc34738282cebbf0034fb_2.file.header.tpl.php
1108 /var/cache/dev/smarty/compile/charme/ba/f0/71/baf0714d120e11446c0237301b6cccbc40531653_2.module.an_simplefreeshippinglineviewstemplatesfrontwidget.tpl.php
1109 /modules/ps_languageselector/ps_languageselector.php
1110 /modules/ps_currencyselector/ps_currencyselector.php
1111 /var/cache/dev/smarty/compile/charme/49/36/e5/4936e564782a528c3079f559922e796453f1af1a_2.module.an_client_serviceviewstemplatesfrontwidget.tpl.php
1112 /modules/darkmode/src/Model/DarkModeOptionsModel.php
1113 /modules/darkmode/src/Db/QueryBuilder.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_clearcache.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1116 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1117 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_cacheresourcefile.php
1118 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1120 /var/cache/dev/smarty/compile/charme/a3/cf/9f/a3cf9f8dbcef1e72a52283b913857be8db6a8b80_2.module.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.cache.php
1121 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1122 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1123 /var/cache/dev/smarty/cache/charme/c1/a7/2c/c1a72c252117bd1fec1cb4f6f00cba678d40c25e.darkmodeviewstemplatesfrontdarkmode_switcher.tpl.php
1124 /modules/ps_customersignin/ps_customersignin.php
1125 /var/cache/dev/smarty/compile/charme/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1126 /var/cache/dev/smarty/compile/charme/62/b3/ea/62b3ea25f9be6f347bb81fe6309b35116e17553f_2.module.an_wishlistviewstemplatesfrontnav.tpl.php
1127 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1128 /var/cache/dev/smarty/compile/charme/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1129 /modules/an_logo/an_logo.php
1130 /modules/an_logo/translations/it.php
1131 /var/cache/dev/smarty/compile/charme/74/96/d2/7496d2b81ba6ced33a36c630e03cb86d3b647a4b_2.module.an_logoviewstemplatesfrontlogo.tpl.php
1132 /var/cache/dev/smarty/compile/charme/bd/eb/23/bdeb239cddb118da7e29251e756fe96cb3dbe26b_2.file.an_megamenu.tpl.cache.php
1133 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/c8/78/eb/c878eb97802eb13f30e8b429c3b7ae2b75dcd622.an_megamenu.tpl.php
1134 /var/cache/dev/smarty/compile/charme/11/0e/c7/110ec72aa9921d2c382ad628bdb2f0bc5105a617_2.module.ps_searchbarps_searchbar.tpl.php
1135 /var/cache/dev/smarty/compile/charme/6a/4b/17/6a4b178cc6ac5016a51cc4db2dda74b30a8cd612_2.file.an_megamenu_mobile.tpl.cache.php
1136 /var/cache/dev/smarty/cache/an_megamenu/1/1/1/10/charme/5a/66/1a/5a661a94d7aee5c45711c1468e52b90ae1e41096.an_megamenu_mobile.tpl.php
1137 /modules/paypal/classes/InstallmentBanner/BannerManager.php
1138 /modules/paypal/classes/InstallmentBanner/Banner.php
1139 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/b6/b4/37/b6b437561c01fc88997451a413028764044621b6_2.file.notifications.tpl.php
1140 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/5b/7f/12/5b7f12aebdf137ed79e78dddcd112712d43e20b5_2.file.breadcrumb.tpl.php
1141 /modules/ps_categorytree/ps_categorytree.php
1142 /var/cache/dev/smarty/compile/charme/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1143 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1144 /var/cache/dev/smarty/compile/charme/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1145 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/22/46/68/2246682b55d5939ba2438c9cba4d4cef07b7d99c_2.file.products-top.tpl.php
1146 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/e7/d5/5d/e7d55de2607b7a3747d835209dfa0bf329274823_2.file.sort-orders.tpl.php
1147 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/cc/2a/92/cc2a920e103307f38418741dbd6eeb78d4f4244b_2.file.products.tpl.php
1148 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/64/de/36/64de36afa8ae49504410858f9ee0be9233599a2b_2.file.product.tpl.php
1149 /var/cache/dev/smarty/compile/charme/62/77/7b/62777bbf995f423da45bdc9d94b3b2255e0685b7_2.module.an_wishlistviewstemplatesfrontproductminiature.tpl.php
1150 /var/cache/dev/smarty/compile/charme/b8/c2/d3/b8c2d37a7784d2c0bb28c4512a21f9b34473d1ad_2.file.productattributes.tpl.php
1151 /var/cache/dev/smarty/compile/charme/c2/f6/38/c2f6388ad4d70d04993a1b28e28ed73fbe5270a8_2.module.an_productattributesviewstemplatesfrontproductattributeswrapper.tpl.php
1152 /var/cache/dev/smarty/compile/charme/50/e3/6e/50e36e4f3c2a4795be15b313ca9e72dc460a5959_2.file.product-variants.tpl.php
1153 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/a9/33/f4/a933f46e6d0f30297d17cc3e63762fa9de0d686c_2.file.pagination.tpl.php
1154 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/03/b6/70/03b67016d311f010e0c867f508f78946bb5f1315_2.file.products-bottom.tpl.php
1155 /var/cache/dev/smarty/compile/charmelayouts_layout_left_column_tpl/38/2a/57/382a577075ddb0537c28ca99407fca0d658514ed_2.file.footer.tpl.php
1156 /modules/ps_contactinfo/ps_contactinfo.php
1157 /var/cache/dev/smarty/compile/charme/99/92/f3/9992f3fe04dd41bcec1a2029cf07bead637caf4d_2.module.ps_contactinfops_contactinfo.tpl.php
1158 /modules/ps_linklist/ps_linklist.php
1159 /modules/ps_linklist/src/Presenter/LinkBlockPresenter.php
1160 /modules/ps_linklist/src/Filter/LinkFilter.php
1161 /modules/ps_linklist/src/Filter/BestSalesRouteFilter.php
1162 /modules/ps_linklist/src/Filter/RouteFilterInterface.php
1163 /modules/ps_linklist/src/LegacyLinkBlockRepository.php
1164 /modules/ps_linklist/src/Model/LinkBlock.php
1165 /classes/CMS.php
1166 /var/cache/dev/smarty/compile/charme/90/65/48/906548e89c8c6025457ddaeffb1980a0c743b872_2.module.ps_linklistviewstemplateshooklinkblock.tpl.cache.php
1167 /var/cache/dev/smarty/cache/ps_linklist/displayFooter/1/1/1/10/charme/9b/96/12/9b961212a8801fe03413e1e2e45b4c5f83cb80fa.ps_linklistviewstemplateshooklinkblock.tpl.php
1168 /var/cache/dev/smarty/compile/charme/94/04/dd/9404dddf9d62e01629bc90a9cb65c9dd834a2134_2.module.darkmodeviewstemplatesfrontdarkmode_functions.tpl.cache.php
1169 /var/cache/dev/smarty/cache/charme/36/f1/62/36f16280300d41cb690e56d19c13bd3f898aeb3d.darkmodeviewstemplatesfrontdarkmode_functions.tpl.php
1170 /modules/ps_customeraccountlinks/ps_customeraccountlinks.php
1171 /var/cache/dev/smarty/compile/charme/42/f9/46/42f9461127ce7396a601c2484841253ea5ba658f_2.module.ps_customeraccountlinksps_customeraccountlinks.tpl.cache.php
1172 /var/cache/dev/smarty/cache/ps_customeraccountlinks/1/1/1/10/charme/b8/de/95/b8de9504ea6f69108346ba83b0a129181d72fbc3.ps_customeraccountlinksps_customeraccountlinks.tpl.php
1173 /var/cache/dev/smarty/compile/charme/b7/0c/56/b70c564919bbf154e7811f43c0a130bb3dc49f9f_2.file.display_footer.tpl.php
1174 /modules/an_copyright/an_copyright.php
1175 /modules/an_copyright/translations/it.php
1176 /var/cache/dev/smarty/compile/charme/56/a5/c8/56a5c82cce1796d8dbfa7b0b327052e3fece4682_2.module.an_copyrightviewstemplatesfrontwidget.tpl.php
1177 /var/cache/dev/smarty/compile/charme/31/32/2b/31322b94623342814b8c7d4182cfda837762840e_2.module.an_trust_badgesviewstemplatesfrontwidget.tpl.php
1178 /modules/statsdata/statsdata.php
1179 /classes/Connection.php
1180 /classes/Page.php
1181 /classes/ConnectionsSource.php
1182 /classes/DateRange.php
1183 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
1184 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
1185 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
1186 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
1187 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
1188 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
1189 /var/cache/dev/smarty/compile/charme/9b/b4/49/9bb449ecf8392afc0ebd444efd0e58f7f03bd397_2.file.ga_tag.tpl.php